Align 3-ketoacyl-CoA thiolase [isoleucine degradation] (EC 2.3.1.16) (characterized)
to candidate WP_004513384.1 GMET_RS08650 acetyl-CoA C-acyltransferase
Query= reanno::MR1:200842 (396 letters) >NCBI__GCF_000012925.1:WP_004513384.1 Length = 391 Score = 395 bits (1016), Expect = e-115 Identities = 204/388 (52%), Positives = 264/388 (68%) Query: 8 QEIVIVAAKRTPMGSFQGSLSGITSLSLAATAIKALLADTQVAPDKVDEVLMGCVLPAGL 67 Q++ +V A RTP GSF G L+ + + LAAT +K LLA +APD V+EV++G VL G Sbjct: 2 QDVFVVDALRTPFGSFSGMLADVEAPKLAATVMKELLAKAGLAPDTVNEVIVGQVLSGGC 61 Query: 68 GQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGGMESMSQA 127 GQAPARQA GAG+P S A T+NKVCGSG+K +ML D I+ G +++VIAGGME+MS A Sbjct: 62 GQAPARQAMRGAGIPDSAHALTINKVCGSGLKAIMLGADSIRLGESQIVIAGGMENMSLA 121 Query: 128 PYLLDKARAGIRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQMDAFALS 187 P+ L KARAG RMGH ++LD + DGL+D YTG MG + +A+ G+TR++ DAFA Sbjct: 122 PFFLKKARAGYRMGHSELLDLLIYDGLQDPYTGRHMGEIGEVSAERGGLTRKEQDAFARR 181 Query: 188 SLEKANAAINSGAFKTEIVPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAFAKDGTIT 247 S E A AA+ G F EIVPV ++GD TI TDE+P P K+P+LR AF KDGTIT Sbjct: 182 SYELAQAAVTGGIFADEIVPVVKKGKKGDETIGTDEEPFKGDPSKLPSLRAAFKKDGTIT 241 Query: 248 AANSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPALFTTAPVGAMAKLLSN 307 A N+S+I+DGAA +LT ++ LT A I T ++ P F AP+GA+ K + Sbjct: 242 AGNASTINDGAALALLTDADGLKKHNLTPKARIVASATESRHPDNFPEAPIGAIEKACAK 301 Query: 308 VGWSKDEVDLFEINEAFAMVTMLAVSELGLDMTKVNVNGGACALGHPIGCSGARLLVTLI 367 G + ++DLFEINEAFA V +LA+ LGL + KVNVNGGACA+GHPIG SG RL T+I Sbjct: 302 AGLTVSDIDLFEINEAFASVALLAIKGLGLPLDKVNVNGGACAIGHPIGASGGRLAATVI 361 Query: 368 HALKARGLKRGVASLCIGGGEATAMAIE 395 L R + G+A+LCIGGGEA A+ E Sbjct: 362 RELHRRQKRYGLATLCIGGGEAVAVIFE 389 Lambda K H 0.316 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 391 Length adjustment: 31 Effective length of query: 365 Effective length of database: 360 Effective search space: 131400 Effective search space used: 131400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_004513384.1 GMET_RS08650 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.4109.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-131 423.3 0.5 4.7e-131 423.2 0.5 1.0 1 lcl|NCBI__GCF_000012925.1:WP_004513384.1 GMET_RS08650 acetyl-CoA C-acyltr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012925.1:WP_004513384.1 GMET_RS08650 acetyl-CoA C-acyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.2 0.5 4.7e-131 4.7e-131 1 385 [] 6 389 .. 6 389 .. 0.98 Alignments for each domain: == domain 1 score: 423.2 bits; conditional E-value: 4.7e-131 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaag 69 +vda+Rtp+g++ g l++++a +L+a+v+kell++agl p+ ++evi+G+vl+ g+++++aR+a+ ag lcl|NCBI__GCF_000012925.1:WP_004513384.1 6 VVDALRTPFGSFSGMLADVEAPKLAATVMKELLAKAGLAPDTVNEVIVGQVLSGGCGQAPARQAMRGAG 74 79******************************************************************* PP TIGR01930 70 lpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakled 138 +p+s alt+n+vC+Sgl+A++l+a++i+ Ge ++v+aGG+E+mS +p++lk++ r+++++g+++l d lcl|NCBI__GCF_000012925.1:WP_004513384.1 75 IPDSAHALTINKVCGSGLKAIMLGADSIRLGESQIVIAGGMENMSLAPFFLKKA--RAGYRMGHSELLD 141 ****************************************************98..89*********** PP TIGR01930 139 qllkdl...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..k 202 l++d+ ++t+ +mge e a++ g++R+eqD++a rS++ a++A+ g f+deivpv+ kgk + lcl|NCBI__GCF_000012925.1:WP_004513384.1 142 LLIYDGlqdPYTGRHMGEIGEVSAERGGLTRKEQDAFARRSYELAQAAVTGGIFADEIVPVVKKGKkgD 210 *********99**************************************************99999999 PP TIGR01930 203 kvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivs 271 +++ +De++ + kL +L++afk+ +g t+tAgN+s +nDGAa++ll+ + +k+++ltp+ariv+ lcl|NCBI__GCF_000012925.1:WP_004513384.1 211 ETIGTDEEPF-KGDPSKLPSLRAAFKK-DG-TITAGNASTINDGAALALLTDADGLKKHNLTPKARIVA 276 999***9998.56789*********95.9*.6************************************* PP TIGR01930 272 aavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiA 340 a+ + +p++++ +p+ Aieka +kagl++sdidl+EinEAFA+++l+++k lg l l+kvNvnGGA A lcl|NCBI__GCF_000012925.1:WP_004513384.1 277 SATESRHPDNFPEAPIGAIEKACAKAGLTVSDIDLFEINEAFASVALLAIKGLG-LPLDKVNVNGGACA 344 ******************************************************.88************ PP TIGR01930 341 lGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 +GHP+GasG+r+ +t+++eL++r+k+yGlatlC+ggG ++Avi+e lcl|NCBI__GCF_000012925.1:WP_004513384.1 345 IGHPIGASGGRLAATVIRELHRRQKRYGLATLCIGGGEAVAVIFE 389 *******************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.89 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory