Align 2-methylcitrate synthase, mitochondrial; Methylcitrate synthase; (2S,3S)-2-methylcitrate synthase; Citrate synthase 2; EC 2.3.3.5; EC 2.3.3.16 (characterized)
to candidate WP_004513388.1 GMET_RS05630 hypothetical protein
Query= SwissProt::Q6C793 (465 letters) >NCBI__GCF_000012925.1:WP_004513388.1 Length = 438 Score = 429 bits (1104), Expect = e-125 Identities = 221/432 (51%), Positives = 290/432 (67%), Gaps = 6/432 (1%) Query: 31 GLKERFAELIPENVEKIKKLRKEKGNTVIGEVILDQAYGGMRGIKGLVWEGSVLDPEEGI 90 GLKE + I E + +L KE G I EV ++Q GG R I+ LV + S LDP+EGI Sbjct: 2 GLKETLKQKIEEFRPRTTRLVKEFGKVKIDEVTIEQCIGGARDIRSLVTDISYLDPQEGI 61 Query: 91 RFRGLTIPDLQKQLPHAPGGKEPLPEGLFWLLLTGEIPTDAQVKGLSADWASRAEIPKHV 150 RFRG TIP+ LP APG P E ++ LLTGE+PT AQV + +W R E+P++V Sbjct: 62 RFRGKTIPETFAALPKAPGSDYPTVESFWYFLLTGEVPTQAQVDEVLTEWKVRQEVPQYV 121 Query: 151 EELIDRCPPTLHPMAQLGIAVNALESESQFTKAYEKG-VNKKEYWQYTYEDSMNLIAKLP 209 + I P HPMA L + + A++ +S+F Y G NK W+ YED+ +++A++P Sbjct: 122 FDTIRTLPRDSHPMAMLSVGITAMQRDSKFAALYNAGKFNKLSAWESVYEDACDIVARIP 181 Query: 210 VIASRIYRNLFKDGKIVGSIDNSLDYSANFASLLGFGDNKEFIELLRLYLTIHADHEGGN 269 VIA+ IY +K K + +ID +LD ANFA ++ GD + ++ R+Y +H+DHE GN Sbjct: 182 VIAAFIYNLKYKGDKQI-AIDPALDMGANFAHMIDQGD--AYKDVARMYFILHSDHESGN 238 Query: 270 VSAHTTKLVGSALSSPFLSLSAGLNGLAGPLHGRANQEVLEWILEMKSKIGSDV--TKED 327 VSAHTT LV SALS P+ + +AGLNGLAGPLHGRANQEVL+W ++ + K D TKE Sbjct: 239 VSAHTTHLVHSALSDPYYAYAAGLNGLAGPLHGRANQEVLDWTIKFQEKYCKDQEPTKEL 298 Query: 328 IEKYLWDTLKAGRVVPGYGHAVLRKTDPRYTAQREFALEHMPDYDLFHLVSTIYEVAPKV 387 I + LWDTL +G+V+PGYGHAVLRKTDPRY +QREF +H+P+ LF LVS I+EVAP V Sbjct: 299 ITRALWDTLNSGQVIPGYGHAVLRKTDPRYISQREFCQKHLPEDPLFKLVSMIFEVAPGV 358 Query: 388 LTEHGKTKNPWPNVDSHSGVLLQYYGLTEQSYYTVLFGVSRAIGVLPQLIMDRAYGAPIE 447 LTEHGKTKNPWPNVD+ SGV+ +YG+ E +YTVLFGV RA+G + + DR G IE Sbjct: 359 LTEHGKTKNPWPNVDAQSGVIQWHYGVKEWDFYTVLFGVGRALGCMANITWDRGLGYAIE 418 Query: 448 RPKSFSTEKYAE 459 RPKS +T E Sbjct: 419 RPKSVTTPMLEE 430 Lambda K H 0.317 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 465 Length of database: 438 Length adjustment: 33 Effective length of query: 432 Effective length of database: 405 Effective search space: 174960 Effective search space used: 174960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory