Align Iron-sulfur cluster-binding oxidoreductase, CCG domain pair-containing, putative benzoyl-CoA reductase electron transfer protein (characterized, see rationale)
to candidate WP_004514140.1 GMET_RS08625 4Fe-4S dicluster domain-containing protein
Query= uniprot:Q39TW0 (387 letters) >NCBI__GCF_000012925.1:WP_004514140.1 Length = 671 Score = 248 bits (634), Expect = 3e-70 Identities = 145/400 (36%), Positives = 205/400 (51%), Gaps = 26/400 (6%) Query: 2 GAIVETVTPYKEIIDVIKEKGGDSLKYCYQCGLCDSVCP-WNRVRQFSMRKIVRQ----- 55 GA T +K+I D C C C CP W + S K+V+Q Sbjct: 274 GATKVTDLTWKDIFDA---------DACTSCKRCQDRCPAWATEKPLSPMKVVKQVCEAA 324 Query: 56 ---GTFGLTEIEQEDI-WRCSTCGTCPSRCPRGVNQIEAGVAMRR-IGAEYDVYPGHVGT 110 L E D+ W C+TC C CP + + + MRR + +PG Sbjct: 325 WSAPDSSLVETVTADVLWSCTTCRACQDVCPAEIEHVNKILEMRRSLSLMEGEFPGD--E 382 Query: 111 IRNVVASLTSEGNSLGGDRTQRGDWAKDLPVKPYAEGME--LLYFTGCYLSYDPRMRKVA 168 +R V+++ GN G RGDWA+ LPV +EG E +LYF GCY S+D R R+VA Sbjct: 383 VRTAVSNVEVNGNPFGLAYASRGDWAEGLPVARVSEGEEADILYFAGCYASFDKRNREVA 442 Query: 169 AATAAILNKAGVDFGILGSKESCCGESIRKTGNEELFKRLAKENIKQFIDNGVTKILVSS 228 + I AG+ GILG E CCGE +RK GNE L++ +A+ENI+ +G K++ + Sbjct: 443 RSFVKICAAAGIRVGILGKDEKCCGEPVRKLGNEYLYQMMAQENIEMMKASGAKKVVTTC 502 Query: 229 PHCYHTFVNEYPEFKVNFEVVFISQYIGQLINEGRLQITGEFAK-KVTYHDPCYLGRHNG 287 PHC++T +Y + E + +I L+ GRL + E + TYHD CYLGR+ Sbjct: 503 PHCFNTLSRDYRDLGFELETEHYATFIHNLMESGRLSLAPEQKRFPFTYHDSCYLGRYKD 562 Query: 288 IYDEPRQVLQQVPGLELLEMADNRESSLCCGGGGGRIWMETPKEERFADLRIRQAVDVGA 347 I+ EPR VL G +L EM + S CCG GGGRI E + ++ R+R A + GA Sbjct: 563 IFAEPRAVLAAAGG-DLREMDRSGCDSFCCGAGGGRILAEEKLGTKISEARVRMAGETGA 621 Query: 348 TVLATSCPYCITNFTDSSLDLADHEKVEVKDLAEIILEVI 387 +L ++CP+C+T F D E ++V+DLAEI+ E I Sbjct: 622 QLLVSNCPFCLTMFEDGIKTGGFEESIKVRDLAEIVAERI 661 Lambda K H 0.320 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 655 Number of extensions: 37 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 671 Length adjustment: 34 Effective length of query: 353 Effective length of database: 637 Effective search space: 224861 Effective search space used: 224861 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory