Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_005452578.1 SACCYDRAFT_RS00460 KR domain-containing protein
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000244975.1:WP_005452578.1 Length = 253 Score = 273 bits (697), Expect = 3e-78 Identities = 146/256 (57%), Positives = 183/256 (71%), Gaps = 4/256 (1%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADI 60 M IAN IV+G ASGLGAATA+ L GA+V DL +A E D AD+ Sbjct: 1 MQIANTAAIVTGGASGLGAATAKALAAKGARVFAADLGPSIAKA---EPTDGVTLVEADV 57 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFN 120 +D + AVDAA + L +VNCAGI A ++L K+GPH L F KV+ VNLIG+FN Sbjct: 58 TDADQVRRAVDAATGSGAPLRVVVNCAGIGPASRILSKKGPHDLDLFRKVVEVNLIGTFN 117 Query: 121 LLRLAAAAMAEGA-ADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAAREL 179 ++ LAA AMA D+SG+RGV+INTAS+AA++GQIGQ AY+ASKG +A +T+PAAR+L Sbjct: 118 VMTLAAQAMATTEPVDDSGQRGVVINTASVAAFEGQIGQIAYSASKGGVAGMTIPAARDL 177 Query: 180 ARFGIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIENSML 239 A GIRV TIAPGI +TPMMAG+++E R SLAA VPFP RLGRP EYA LA +I+E+ L Sbjct: 178 ASHGIRVTTIAPGIIDTPMMAGITEEFRESLAASVPFPQRLGRPDEYAQLAVNIVEHDYL 237 Query: 240 NGEVIRLDGALRMAAK 255 NGEVIR+DGALRM+ + Sbjct: 238 NGEVIRMDGALRMSPR 253 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory