Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_005452749.1 SACCYDRAFT_RS00960 UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
Query= SwissProt::Q9ZDJ5 (341 letters) >NCBI__GCF_000244975.1:WP_005452749.1 Length = 327 Score = 199 bits (506), Expect = 8e-56 Identities = 113/279 (40%), Positives = 173/279 (62%), Gaps = 8/279 (2%) Query: 6 TLMITGGTGSFGNAVLSRFLKSNIINDIKEIRIFSRDEKKQEDMRIALNNS-KLKFYIGD 64 ++++TGGTGSFG A + L +N + + + SRDE KQ +++ N +L+++IGD Sbjct: 8 SILLTGGTGSFGKAFIDYALAE--LNP-RRLVVLSRDELKQYEVKQQFGNDPRLRWFIGD 64 Query: 65 VRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAINNKVTKVI 124 VR+ + ++ AMHGVDYV HAAALKQV T E+ P E + TNV+G++NV+ AAI+ V KV+ Sbjct: 65 VRDRRRLERAMHGVDYVVHAAALKQVDTGEYNPFEFVQTNVMGSQNVIEAAIDTGVKKVV 124 Query: 125 VLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGSVIPLFIH 184 LSTDKA PIN G +K +++ I+ + V RYGNVMASRGSVIP F Sbjct: 125 ALSTDKASSPINLYGATKLCADRMFISANHYAATHPARFAVVRYGNVMASRGSVIPFFRS 184 Query: 185 QIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTIEVLAKALQE 244 ++G+ L IT MTRF ++L +V V+ +F+ R G+++V + P+ + LA+A+ Sbjct: 185 LAERGESLPITHKDMTRFWITLPQAVKFVVDSFDLMRGGELYVPRIPSMRLVDLAQAI-- 242 Query: 245 IFGSKNAIRFIGTRHGEKHYESLVSSEDMAKADDLGGYY 283 + + +G R GEK +E +++ +D + LG Y Sbjct: 243 --APGSPMHEVGIRPGEKLHEEMIAPDDSRRTVRLGDRY 279 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 327 Length adjustment: 28 Effective length of query: 313 Effective length of database: 299 Effective search space: 93587 Effective search space used: 93587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory