Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_005452808.1 SACCYDRAFT_RS01140 histidinol-phosphate transaminase
Query= reanno::BFirm:BPHYT_RS14905 (370 letters) >NCBI__GCF_000244975.1:WP_005452808.1 Length = 351 Score = 224 bits (571), Expect = 3e-63 Identities = 141/333 (42%), Positives = 186/333 (55%), Gaps = 8/333 (2%) Query: 37 VKLASNENPLGMPESAQRAMAQAASELGRYPDANAFELKAALSERYGVPADWVTLGNGSN 96 VKLASNE P G S A+A+A+ E+ RYPD A+ L LS VP V +G GS Sbjct: 26 VKLASNEVPGGPLPSVADAIARASREINRYPDMGAWALVDRLSRELDVPTSQVAVGCGSV 85 Query: 97 DILEIAAHAFVEKGQSIVYAQYSFAVYALATQGLGARAIVVPAV-KYGHDLDAMLAAVSD 155 + + A G +++A SF Y + TQ A + VP + HDLDAMLAA++ Sbjct: 86 SLCQQFVQALCAPGDEVLFAWRSFEAYPIVTQVGNATPVRVPLTPSHTHDLDAMLAAITP 145 Query: 156 DTRLIFVANPNNPTGTFIEGPKLEAFLDKVPRHVVVVLDEAYTEYLPQEKRYDSIAWVRR 215 TRL+FV NPNNPTGT + +L FLD VP VVVVLDEAY E++ D + + R Sbjct: 146 KTRLVFVCNPNNPTGTAVRRAELTRFLDNVPSDVVVVLDEAYREFVTDADVPDGLEFART 205 Query: 216 YPNLLVSRTFSKAFGLAGLRVGFAIAQPELTDLLNRVRQPFNVNTLAQAAAIAALNDKAF 275 PN+ V RTFSKA+GLAGLRVG+A+A E+ + + +V F+VN LAQ AA+A+L+ K Sbjct: 206 RPNVAVLRTFSKAYGLAGLRVGYAVAADEVIEAVRKVYVAFSVNALAQTAALASLDAKDE 265 Query: 276 LEKSAALNAQGYRRLTEAFDKLGLEYVPSDGNFVLVRVGNDDAAGNRVNLELLKQGVIVR 335 L A R+ E LG E + NFV + +G A +LE V+VR Sbjct: 266 LLARCADIVAERTRVHETLRDLGYEVPETLANFVWLPLGERTTAFAEHSLE---HKVVVR 322 Query: 336 PVGNYGLPQWLRITIGLPEENEAFIAALERTLA 368 P G +R+TIG EEN+ F+ A LA Sbjct: 323 PFAGEG----VRVTIGTREENDTFLEAARAFLA 351 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 351 Length adjustment: 29 Effective length of query: 341 Effective length of database: 322 Effective search space: 109802 Effective search space used: 109802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory