Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_005455729.1 SACCYDRAFT_RS09590 triose-phosphate isomerase
Query= BRENDA::P9WG43 (261 letters) >NCBI__GCF_000244975.1:WP_005455729.1 Length = 261 Score = 388 bits (997), Expect = e-113 Identities = 190/261 (72%), Positives = 215/261 (82%) Query: 1 MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD 60 M+RKPLIAGNWKMNLNH EAIALVQKIAFSLP+KYY +VDV V+PPFTD+RSVQTLVDGD Sbjct: 1 MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPEKYYAKVDVTVLPPFTDIRSVQTLVDGD 60 Query: 61 KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT 120 KL LTYGAQDLSPHDSGAYTGDVSGA LAKLGC+YVVVGHSERR YH E D +V K Sbjct: 61 KLLLTYGAQDLSPHDSGAYTGDVSGAMLAKLGCTYVVVGHSERREYHAETDEVVNKKVRA 120 Query: 121 ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG 180 ALKHG++PI+C+GE LDVREAGNH+ H QL +L GL AEQ+ VV+AYEPVWAIGTG Sbjct: 121 ALKHGISPILCVGEKLDVREAGNHIEHTTSQLIAALKGLKAEQVEQVVVAYEPVWAIGTG 180 Query: 181 RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG 240 RVA+ ADA+EVCAA+R L+ +A +RVLYGGSV + NV D+V D+VDG LVGG Sbjct: 181 RVATPADAEEVCAALRSALSDKYGAELAQGIRVLYGGSVKSGNVADLVKCDNVDGALVGG 240 Query: 241 ASLDGEHFATLAAIAAGGPLP 261 ASLDGE F L A+AAGGPLP Sbjct: 241 ASLDGEEFTKLCALAAGGPLP 261 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 261 Length adjustment: 25 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_005455729.1 SACCYDRAFT_RS09590 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.28489.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-59 184.9 0.5 1.1e-58 184.7 0.5 1.0 1 lcl|NCBI__GCF_000244975.1:WP_005455729.1 SACCYDRAFT_RS09590 triose-phosph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000244975.1:WP_005455729.1 SACCYDRAFT_RS09590 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 184.7 0.5 1.1e-58 1.1e-58 1 226 [. 6 244 .. 6 246 .. 0.92 Alignments for each domain: == domain 1 score: 184.7 bits; conditional E-value: 1.1e-58 TIGR00419 1 lviinfKlnesvgkvelevaklaeevase..agvevavappfvdldvvkdeve.se..iqvaAqnvdav 64 l+ +n+K+n + +v+k+a + ++ a+v v+v ppf d++ v+ v+ + ++ +Aq++ + lcl|NCBI__GCF_000244975.1:WP_005455729.1 6 LIAGNWKMNLNHLEAIALVQKIAFSLPEKyyAKVDVTVLPPFTDIRSVQTLVDgDKllLTYGAQDLSPH 74 689***********************9974468899999**********9999544225668******* PP TIGR00419 65 ksGaftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaar 133 +sGa+tG++s +ml+ lG+ +v++gHsErR +++e+de+++kkv + + g+ +++Cvge l+ rea++ lcl|NCBI__GCF_000244975.1:WP_005455729.1 75 DSGAYTGDVSGAMLAKLGCTYVVVGHSERREYHAETDEVVNKKVRAALKHGISPILCVGEKLDVREAGN 143 ********************************************************************9 PP TIGR00419 134 tinnvattaaaaA.......lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvr 194 +i+ + + aa e++vvA+EPv++iGtG+++++A+ae+v + +r l+ +e+a+ +r lcl|NCBI__GCF_000244975.1:WP_005455729.1 144 HIEHTTSQLIAALkglkaeqVEQVVVAYEPVWAIGTGRVATPADAEEVCAALRSALSDkYGAELAQGIR 212 999876655554488888999*********************************9987699******** PP TIGR00419 195 vlyGasvtaaedaelaaqldvdGvLlasavlk 226 vlyG+sv++++ a+l+ +vdG+L+++a+l lcl|NCBI__GCF_000244975.1:WP_005455729.1 213 VLYGGSVKSGNVADLVKCDNVDGALVGGASLD 244 *****************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (261 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.75 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory