Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_005456121.1 SACCYDRAFT_RS10830 alpha-ketoacid dehydrogenase subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_000244975.1:WP_005456121.1 Length = 330 Score = 266 bits (680), Expect = 5e-76 Identities = 141/324 (43%), Positives = 210/324 (64%), Gaps = 3/324 (0%) Query: 1 MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE 60 M V+SY +A+ ++EE+ RD V ++GE++G GG +K T+GL E+FGE+RV DTP+AE Sbjct: 1 MPVISYREALRNTLREELRRDDDVLLIGEEIGVFGGSYKITSGLLEEFGEKRVRDTPIAE 60 Query: 61 SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG 120 G +GAAM G+RPI E+ +F + A++QI++ AAKI S P+V+R P G Sbjct: 61 EGFVGAAVGAAMLGLRPIVEIMTINFSLLALDQIVNHAAKIYGMFGGQTSVPMVIRTPGG 120 Query: 121 GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLI 180 GG HSQ++E +A PGLK+V PSTP DA+ LL AAVRD+DPVLF E+ Y Sbjct: 121 GGQQLGATHSQNIELYYAFVPGLKVVAPSTPADARALLLAAVRDDDPVLFLENLALYN-T 179 Query: 181 KGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERL-EKDGISAHVVDLRTV 239 KGEVP D IG+A V REG DIT++ Y A++ A+RL ++ G+SA V+DLR++ Sbjct: 180 KGEVPDDLGPAEIGRAAVVREGTDITIVGYSRMAAVAVEVADRLRDESGVSAEVIDLRSL 239 Query: 240 YPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPA 299 PLD+E ++ +A +TG V++ +D + +E+AA IS+ LDAP++R+A ++P Sbjct: 240 RPLDRETLVASARRTGCVVVAEDDWLTYGVGAEIAASISDGAFDHLDAPVRRVAAAEVP- 298 Query: 300 MPYAPTMEKYFMVNPDKVEAAMRE 323 +PYA +E + + + + A+ E Sbjct: 299 LPYAKPLETAALPSAESLHTAVLE 322 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 330 Length adjustment: 28 Effective length of query: 299 Effective length of database: 302 Effective search space: 90298 Effective search space used: 90298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory