Align long-chain-aldehyde dehydrogenase (EC 1.2.1.48) (characterized)
to candidate WP_005456227.1 SACCYDRAFT_RS11145 benzaldehyde dehydrogenase
Query= BRENDA::P51648 (485 letters) >NCBI__GCF_000244975.1:WP_005456227.1 Length = 486 Score = 130 bits (327), Expect = 1e-34 Identities = 102/334 (30%), Positives = 163/334 (48%), Gaps = 14/334 (4%) Query: 101 PLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKI-LAKLLPQY-LDQD 158 P+GVV +I +N+P VL I+ + A+A GNAV++KP + + + LA++ + L Sbjct: 143 PVGVVGVISPFNFPLVLAIRSVAPALALGNAVVLKPDPRTAVSGGVTLARVFEEAGLPAG 202 Query: 159 LYIVINGGVEETTELLKQ-RFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYID 217 + V+ GG + L++ R I +TG+T G+ V +A+++L V LELGG S + Sbjct: 203 VLSVLPGGADVGAALVEDPRVPVISFTGSTGAGRTVGASASRNLKKVHLELGGNSAIVVL 262 Query: 218 KDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEF-YGENIKES 276 D DLD G +++ GQ C+ L S+ + V K+ + G+ + Sbjct: 263 DDADLDATVSAGAAGSFLHQGQICMTTGRHLVHESVYEEYVAKLAAKAEALPVGDPMSGK 322 Query: 277 PDYERIINLRHFKRI-----LSLLEGQKIAFGGETDEATRYIAPTVLTDVDPKTKVMQEE 331 II+ +I S+ G ++A GG T E Y PTVL DV +E Sbjct: 323 VALGPIIDQGQLDKIHGMVTASVEAGARLAAGG-TYEGLFY-RPTVLADVPTTAPAYADE 380 Query: 332 IFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMH 391 +FGP+ P+VP DEA+ +E E L+L +F+ + + + +G ND + Sbjct: 381 VFGPVAPVVPFATEDEAVALASESEYGLSLGIFTRDIGRGLELAEAIPTGIAHINDQTVG 440 Query: 392 FTLNSFPFGGVGSSGMGAYHG--KHSFDTFSHQR 423 N PFGG G+SG G G H+ + F+ R Sbjct: 441 DEAN-IPFGGFGASGNGMRFGGATHNIEAFTETR 473 Lambda K H 0.321 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 486 Length adjustment: 34 Effective length of query: 451 Effective length of database: 452 Effective search space: 203852 Effective search space used: 203852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory