Align Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized)
to candidate WP_005456871.1 SACCYDRAFT_RS13365 amino acid permease
Query= TCDB::P15993 (457 letters) >NCBI__GCF_000244975.1:WP_005456871.1 Length = 486 Score = 303 bits (776), Expect = 8e-87 Identities = 160/434 (36%), Positives = 254/434 (58%), Gaps = 8/434 (1%) Query: 12 KRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMVV 71 +R L + +Q+IA GGA+G GLFLG + S GPG+IL Y + G + +L+MR LGEM V Sbjct: 28 RRSLSHLQLQMIAFGGAVGVGLFLGLGEQLSSVGPGLILSYLVVGALVYLLMRALGEMTV 87 Query: 72 EEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWVSA 131 P G F +A ++ G +GW Y + VLV +AE++AVG Y +W+P+ P W+S Sbjct: 88 YRPATGGFVSYAREFVGPRFAHLTGWIYVTVAVLVGIAEISAVGVYTAYWFPDAPAWLSP 147 Query: 132 AVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGW-LLFSGNGGPQATVSNLW 190 V ++ N+ V+ FG +E A IKVIA+V ++ G +LF G+G P+A+V+NLW Sbjct: 148 LVALCLVFGTNVLTVRAFGLIESAAAAIKVIAIVLFLVTGVLVVLFGGSGAPEASVTNLW 207 Query: 191 DQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYI 250 +GGFLPHG +V++M ++FSF +E+ A EA + +S+PKA V++R+ +FYI Sbjct: 208 -EGGFLPHGVWPVVLVMQAVVFSFSAVEVTATAAGEAKDAARSMPKAVRGVVFRLGLFYI 266 Query: 251 GSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVYNSCVYCNSRM 310 GS+ VL L+P + D SPFV LG ++ +N+VVL+A+LS N+ +Y R+ Sbjct: 267 GSVLVLSMLLPTDHYSGDESPFVTALSSLGVPYLGGIMNLVVLSASLSGVNAALYATIRL 326 Query: 311 LFGLAQQGNAPKALASVDKRGVPVNTILVSALVTAL-CVLINYLAPESAFGLLMALVVSA 369 L LA G+APKA +D+RGVP + ++L+ + VLI + S F L + Sbjct: 327 LRNLAAHGSAPKATVLIDRRGVPTGALAFTSLLYLVGVVLILFADAGSVFFLALDAASVG 386 Query: 370 LVINWAMISLAHMKFRRAKQEQGVVT---RFPALLYPLGNWICLLFMAAVLVIMLMTPGM 426 +++ W I ++H++FR ++ + + R P +P +W CL + A+ ++ G Sbjct: 387 ILLAWMAIFVSHLRFRARVRDGSIASVDFRMPG--FPYTDWACLAVLTAIFCSLVFDSGT 444 Query: 427 AISVYLIPVWLIVL 440 A + + V L+ + Sbjct: 445 AYAGLIATVALLAV 458 Lambda K H 0.328 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 609 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 486 Length adjustment: 33 Effective length of query: 424 Effective length of database: 453 Effective search space: 192072 Effective search space used: 192072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory