Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_005457037.1 SACCYDRAFT_RS13945 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_000244975.1:WP_005457037.1 Length = 248 Score = 144 bits (364), Expect = 1e-39 Identities = 97/252 (38%), Positives = 144/252 (57%), Gaps = 21/252 (8%) Query: 9 VITGGAGGLGLAMAHNFAQAGAKLALI----DVDQDKLERACADLGSSTEVQGYALDITD 64 ++TG A G+G +A A+ G ++A D ++ER A+ G+ T Q D+ D Sbjct: 10 LVTGAARGIGREVALRLARDGYRIAGCFRQRGEDAARVERELAEAGARTFFQ--PCDVRD 67 Query: 65 EEDVVAGFAYILED-FGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVINVNLT 123 D V+ F ED G I LVNNAG+ RD V MS +++ +V++ NLT Sbjct: 68 A-DAVSRFVTEAEDALGPITALVNNAGVTRDANTVM---------MSPEEWSTVLDTNLT 117 Query: 124 GTFLCGREAAAAMIESGQAGVIVNISSLAKA-GNVGQSNYAASKAGVAAMSVGWAKELAR 182 GT+ R M++ +AG +VNISS+A GN GQSNYAASKAG+ ++ AKE AR Sbjct: 118 GTWNVCRAVVFRMLKR-RAGAVVNISSIAGVHGNAGQSNYAASKAGIIGLTKSLAKETAR 176 Query: 183 YNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFII--ENDYVN 240 +R+ VAPG I TEMT+A+ + ++ +P+ R G +++A V F++ E+ Y+ Sbjct: 177 AGVRANVVAPGYIDTEMTSALPAKGQDKALAAIPLRRFGRPDDVAPLVAFLLSDESSYIT 236 Query: 241 GRVFEVDGGIRL 252 G+VF VDGG+ L Sbjct: 237 GQVFAVDGGMVL 248 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 248 Length adjustment: 24 Effective length of query: 228 Effective length of database: 224 Effective search space: 51072 Effective search space used: 51072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory