Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate WP_005460485.1 SACCYDRAFT_RS24875 2-oxo acid dehydrogenase subunit E2
Query= reanno::Smeli:SMc03203 (426 letters) >NCBI__GCF_000244975.1:WP_005460485.1 Length = 467 Score = 227 bits (578), Expect = 7e-64 Identities = 159/459 (34%), Positives = 221/459 (48%), Gaps = 49/459 (10%) Query: 8 MPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVGDT 67 + D EG+ EAE+++W VKPGD V + V+ + T KA VE+P P G V L E G T Sbjct: 9 LADTAEGLTEAEIIDWKVKPGDEVAVNQVVVEIETAKAAVELPIPWAGVVTELLVEPGQT 68 Query: 68 VAVKAPL--VRIETAGEAGEAAPDSIP------EALAEQVLDEPVAVSS---------RL 110 V V P+ V ++ G A + S P EA E+ + V S R Sbjct: 69 VEVGTPILTVDVDPHGTASPSVNGSAPAEAASNEAAGEEEMKPLVGYGSKASSAKRRPRK 128 Query: 111 EAKAPPQPEKPAPKPAPA--------PREAPD-------LSAKPLASPAVRLRARESGID 155 +A P+P +P+PA A PR+AP+ + PLA P VR A+E G+D Sbjct: 129 QAAGSPKPTAESPEPAEAVRAVQVVRPRQAPEDVPGTAPAAYVPLAKPPVRKLAKELGVD 188 Query: 156 LRQVAGTGPAGRITHEDLDLFISRGAEPLPAQTGLVRKTAVE-------------EVRMI 202 LR V G+ G IT ED + R AE + A AV V + Sbjct: 189 LRTVTGSADGGIITRED----VRRAAEGVTATETASAAPAVSAPGGSYDPASRERRVPIR 244 Query: 203 GLRRRIAEKMSLSTSRIPHITYVEEVDMTALEDLRATMNRDRKPEQAKLTILPFLMRALV 262 G+R+ A+ M S PH+T VD+T + +LR + R + KLT L F +A+ Sbjct: 245 GVRKATAQAMVNSAYTAPHVTEFLTVDVTPMMELRDKLRRTPEFADVKLTPLVFAAKAVC 304 Query: 263 KTVAEQPGVNATFDDHAGVIHRHAAVHIGIATQTPAGLTVPVVRHAEARGIWDCAAELNR 322 P VNA +D+ AG I VH+GIA TP GL VP VR A+A+ + + A + Sbjct: 305 LAAKRTPDVNAVWDESAGEIVYKDYVHLGIAAATPRGLVVPKVRDADAKSLVELARAIGE 364 Query: 323 LADAARTGTATRDELTGSTITISSLGAIGGIASTPVINHPEVAIVGVNKIAVRPVWDGAQ 382 L AR G +++ T TI+++G G TP+IN E AI+ + I P + Sbjct: 365 LTTTARDGRTPPEDMLNGTFTITNVGVFGVDTGTPIINPGESAILALGAIRDMPWVVDGE 424 Query: 383 FVPRKIMNLSSSFDHRVIDGWDAAVFVQRLKTLLETPAL 421 RK+M LS SFDHRVIDG + F+ + LL PA+ Sbjct: 425 LAVRKVMQLSLSFDHRVIDGQQGSQFLADVGALLADPAV 463 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 467 Length adjustment: 32 Effective length of query: 394 Effective length of database: 435 Effective search space: 171390 Effective search space used: 171390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory