Align aminomethyltransferase; EC 2.1.2.10 (characterized)
to candidate WP_005811336.1 DHAF_RS20145 aminomethyltransferase
Query= CharProtDB::CH_000563 (364 letters) >NCBI__GCF_000021925.1:WP_005811336.1 Length = 365 Score = 266 bits (679), Expect = 9e-76 Identities = 155/365 (42%), Positives = 221/365 (60%), Gaps = 16/365 (4%) Query: 3 QQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRT 62 ++TPLYEQH GA+++DF GW MP+ Y I+EH AVR+ AG+FDVSHM V+L+G + Sbjct: 5 KRTPLYEQHRRAGAKLIDFGGWEMPVQYAGVIEEHKAVRSKAGLFDVSHMGEVELKGKDS 64 Query: 63 REFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDL 122 FL+YLL NDV+++ + + YS M ++GGV+DDL+VY ++ + F LVVN++ +KD Sbjct: 65 LAFLQYLLTNDVSRI-QDNQIQYSPMCTSAGGVVDDLLVYRYSREHFLLVVNASNTDKDF 123 Query: 123 SWITQHAEPFGIEITVRD-DLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQAGD 181 +W+ AE F I + R D + +A+QGP A+ L + Q V Sbjct: 124 AWMQAQAEGFEISLENRSGDFAQLALQGPWAEKILQKLTSMDLAQINYYWFKHGEVDGVL 183 Query: 182 LFIATTGYTGEAGYEIALPNEKAADFWRALVEA----GVKPCGLGARDTLRLEAGMNLYG 237 I+ TGYTGE G+EI LP E A W ++E GV+P GLGARDTLR EA + LYG Sbjct: 184 CLISRTGYTGEDGFEIYLPPEHAPRMWERILEVGGSEGVQPIGLGARDTLRFEARLPLYG 243 Query: 238 QEMDETISPLAANMGWTIAWEPADRDFIGREALEVQREHGT-EKLVGLVMTEKGVLRNEL 296 E+ I+PL A +G+ + E +FIG+EAL Q+E G KLVGL M E+G+ R+ Sbjct: 244 NELGPDITPLEAGLGFFVKLE--KDNFIGKEALSAQKEKGVPRKLVGLEMIERGIARSHY 301 Query: 297 PVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVP---EGIGETAIVQIRNREMPVKVTK 353 P++ + + G ITSG+FSPTL +IAL +P IGET V IR + + ++ Sbjct: 302 PLQ----KEGKEIGFITSGSFSPTLNKNIALGLIPPEYAQIGETLDVIIRGKAVKARIIP 357 Query: 354 PVFVR 358 +F + Sbjct: 358 SLFYK 362 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 24 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 365 Length adjustment: 29 Effective length of query: 335 Effective length of database: 336 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_005811336.1 DHAF_RS20145 (aminomethyltransferase)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.9877.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-138 445.0 0.0 1.1e-137 444.8 0.0 1.0 1 lcl|NCBI__GCF_000021925.1:WP_005811336.1 DHAF_RS20145 aminomethyltransfer Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021925.1:WP_005811336.1 DHAF_RS20145 aminomethyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.8 0.0 1.1e-137 1.1e-137 1 362 [] 4 363 .. 4 363 .. 0.98 Alignments for each domain: == domain 1 score: 444.8 bits; conditional E-value: 1.1e-137 TIGR00528 1 lkrtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrll 69 lkrtpLy++h g+kl+df+Gwe+Pvqy+++ieeh+avr kaGlfDvshmg+vel+G++sl+fLq+ll lcl|NCBI__GCF_000021925.1:WP_005811336.1 4 LKRTPLYEQHRRAGAKLIDFGGWEMPVQYAGVIEEHKAVRSKAGLFDVSHMGEVELKGKDSLAFLQYLL 72 69******************************************************************* PP TIGR00528 70 anDvdaLtkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehlee.evtldtl 137 +nDv+++ + qys ++ + GGvvDDl+vy+ + + +fllvvna++++kD +w++ ++e+ e++l++ lcl|NCBI__GCF_000021925.1:WP_005811336.1 73 TNDVSRIQDNQIQYSPMCTSAGGVVDDLLVYRYSRE-HFLLVVNASNTDKDFAWMQAQAEGfEISLENR 140 **********************************99.9*********************9935789999 PP TIGR00528 138 skeisllalqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekave 206 s + + lalqGP a++il++l++ ++ +++ + f ++e+ + +li+rtGytGedGfei++++e+a lcl|NCBI__GCF_000021925.1:WP_005811336.1 141 SGDFAQLALQGPWAEKILQKLTSMDLAQINYYWFK-HGEVDGVLCLISRTGYTGEDGFEIYLPPEHAPR 208 *****************************998887.99**99999************************ PP TIGR00528 207 lwkklvea...ygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravle 272 +w++++e gv+PiGLgarDtLr+ea ++LyG+el +itPleaglg+ vk+e k +fiG+++l+ lcl|NCBI__GCF_000021925.1:WP_005811336.1 209 MWERILEVggsEGVQPIGLGARDTLRFEARLPLYGNELGPDITPLEAGLGFFVKLE--KDNFIGKEALS 275 ******987779*******************************************9..899******** PP TIGR00528 273 eqkengtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiGtkl 341 qke+g+ +klvGlem+e+giar ++++ + +g ke+G +tsG++sPtL+knial++++ e+++iG++l lcl|NCBI__GCF_000021925.1:WP_005811336.1 276 AQKEKGVPRKLVGLEMIERGIARSHYPLQK-EG-KEIGFITSGSFSPTLNKNIALGLIPPEYAQIGETL 342 ***************************999.99.9********************************** PP TIGR00528 342 evevrnklvkikvvkklfvrs 362 +v +r+k vk++++ lf+++ lcl|NCBI__GCF_000021925.1:WP_005811336.1 343 DVIIRGKAVKARIIPSLFYKR 363 ******************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.98 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory