Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_005811549.1 DHAF_RS13515 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_000021925.1:WP_005811549.1 Length = 453 Score = 236 bits (602), Expect = 1e-66 Identities = 162/407 (39%), Positives = 219/407 (53%), Gaps = 17/407 (4%) Query: 3 EALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHP-QLDWSAVDDVIYGCANQAG 61 + + ++A RTP G+ GAL A LGA+ +K ++ R ++ VD VI G QAG Sbjct: 48 QVVCVEACRTPYGKSLGALLEYDAAQLGALAIKEVLRRTKGKVAPGEVDYVIMGHVVQAG 107 Query: 62 EDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMS 121 + +R A LLAGLP VP T+N++C SG+ + A+ + G A +++AGG ESMS Sbjct: 108 SGQVS-SRQATLLAGLPEHVPSITVNKVCSSGVKTIDLGAQMIALGRAEIVIAGGQESMS 166 Query: 122 RAPFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRADQ 181 PF + + GR + V + F M VA +F SR +Q Sbjct: 167 NIPFSLPDMRR--GRKMGLPTIDCVDLMVKDGLWDSFYERHMAIHGSEVADEFGYSREEQ 224 Query: 182 DAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGTP 241 D +AL SQ A+AAIA G+L EI V + K + +E DE PR +TTLE LAKLG Sbjct: 225 DEWALHSQLAASAAIAAGKLDAEIFPVAVKTGK---ETLEKDEGPRANTTLEGLAKLGPV 281 Query: 242 FR-------QGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRI 294 F + GSVTAGNA G NDG LL S A GLK +V A + Sbjct: 282 FDHISAVTGKPGSVTAGNAPGTNDGGDVCLLMSRAKADELGLKPLFSIVDYAEVSQPTKD 341 Query: 295 MGIGPVPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRE-LGLADDD--ERVNPNGG 351 + P + +KVLE L L D+ +IE+NEAFAA L R LG+ + E+VN NGG Sbjct: 342 IATVPGLSIKKVLEQNKLTLEDIKLIEINEAFAAVALVSARTILGMTKEQMYEKVNVNGG 401 Query: 352 AIALGHPLGMSGARLVTTALHELEERQGRYALCTMCIGVGQGIALII 398 AIA GHP+G +GAR+V T +EL+ R G Y +C +C G QG A++I Sbjct: 402 AIAYGHPIGATGARIVMTLAYELKRRGGGYGVCGICAGHAQGDAMLI 448 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 453 Length adjustment: 32 Effective length of query: 369 Effective length of database: 421 Effective search space: 155349 Effective search space used: 155349 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory