Align D-lactate dehydrogenase (acceptor) (EC 1.1.99.6) (characterized)
to candidate WP_005817128.1 DHAF_RS22570 FAD-binding oxidoreductase
Query= BRENDA::O29853 (443 letters) >NCBI__GCF_000021925.1:WP_005817128.1 Length = 462 Score = 263 bits (671), Expect = 1e-74 Identities = 162/438 (36%), Positives = 248/438 (56%), Gaps = 18/438 (4%) Query: 19 AYRFDETPPLVAPRAAENFVVVKPSNSEEVSAILKFANEKSIPVFMRGGGTGLSGGAVPT 78 +Y +D T + P + V V P +E+VS ++K A + +PV+ RG T LSGG +P Sbjct: 28 SYSYDATAAM--PHQTPD-VFVTPKTTEQVSEVMKIATKYDLPVYPRGSATNLSGGTIPI 84 Query: 79 EEGIVLSTEKMTEL-EVDADNRVAICGAGVTLKQLDDAAFRHGLSFPPHPGA-ETATVGG 136 E+GIV+S M ++ EVDA+N A GV ++ L+DAA HGL +PP PG +TAT+GG Sbjct: 85 EKGIVMSMLHMNQIIEVDAENLTATVQPGVIIQDLNDAALEHGLFYPPDPGTVKTATMGG 144 Query: 137 MIATNAGGVRALKYGTMRNYVLSLEAVLADGRIINVGGKTIKNSSGYSLLHLLVGSEGTL 196 ++ ++GG+R LKYG ++YV+ ++ V A+G II GGKT+KN +GY L L G+EGTL Sbjct: 145 SVSESSGGLRGLKYGVTKHYVMGMKLVRANGDIIKWGGKTVKNVTGYDLTALFTGAEGTL 204 Query: 197 AVITKATIRLFPQMRDMTVLAIPFPTMEDAMNCVVEVAR-KMLPMALEFMEKRAVEIGEK 255 +IT+ ++L P L F ++ A N + + R K++P LE M+ + E Sbjct: 205 GIITEIIVKLNPVPEARKALLGVFDDIDKAGNAIAAIIRNKVIPATLEIMDNITIRTVEN 264 Query: 256 VSGERWVSREGEAHLLMVFESFDEAEE-----AAKIAQSLGAIDVYAATTKKDQDRLLKV 310 + + + EA LL + + EA E KI + GA+++ A T +++D++ Sbjct: 265 FT-HAGLPVDAEAILLCEVDGYKEAVEREAALVEKILKEQGAVEINVAKTDEERDKIWLA 323 Query: 311 RGMIYEGL--RKEVIEVLDACVPPAKIAEYWRRSNELAEEYGIELITYGHAGDGNVHQHP 368 R L R+ + DA VP +KI + ++AE+Y + + T+GHAGDGN+H Sbjct: 324 RRNALPALAQRRPTTVLEDATVPRSKIPHMIKAIRQIAEKYDLLIGTFGHAGDGNLHPTI 383 Query: 369 LVYEGWEKSYFEFRKS---LLSLAVSLGGVISGEHGIGAVKLSELEELFPEQ-FELMRQI 424 L E ++ K+ + +AVSLGG +SGEHGIG K L F E +L++ I Sbjct: 384 LTDENNKEEMERVDKAVEEIFQVAVSLGGTLSGEHGIGMAKAKFLPLEFGEAGVKLLKDI 443 Query: 425 KLLFDPKNILNPGKVVRK 442 K DP +NPGK+VR+ Sbjct: 444 KEACDPDYRINPGKMVRR 461 Lambda K H 0.317 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 462 Length adjustment: 33 Effective length of query: 410 Effective length of database: 429 Effective search space: 175890 Effective search space used: 175890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory