Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_006747154.1 THITH_RS14200 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000227685.2:WP_006747154.1 Length = 261 Score = 149 bits (375), Expect = 8e-41 Identities = 87/254 (34%), Positives = 134/254 (52%), Gaps = 14/254 (5%) Query: 13 SPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQ 72 S + L GL+K +G + D+ ++ G + GL+GPNGAGKTT F +L I+PD Sbjct: 18 SAADACLTGSGLTKRYGKRTVLSEVDVHLRHGEVVGLLGPNGAGKTTCFYILVGLIQPDA 77 Query: 73 GEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLIN 132 G + G + + H A G Q A + RLTV +N L ++ Sbjct: 78 GRIELAGRDVTRAPVHLRARLGLGYLPQEASIFRRLTVWQN-------------LQAVLE 124 Query: 133 FRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDE 192 RR + RE A++E L ALSGG+R+ E+ARAL NP+ + LDE Sbjct: 125 LRR-DLDRAGRRETGDALIEEFQLETVRDSPGIALSGGERRRAEIARALAGNPQFVCLDE 183 Query: 193 PAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQ 252 P AGV+P + +I + I + ++GI L+ +HN+ + +C ++L+EGR L++GTP + Sbjct: 184 PFAGVDPISVVEIQDVIGHLKQRGIGVLISDHNVRETLGICDRAYILSEGRLLSEGTPAE 243 Query: 253 IQSDPRVLEAYLGD 266 + +D RV YLG+ Sbjct: 244 LLADHRVRTVYLGE 257 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 261 Length adjustment: 25 Effective length of query: 242 Effective length of database: 236 Effective search space: 57112 Effective search space used: 57112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory