Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_006747154.1 THITH_RS14200 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000227685.2:WP_006747154.1 Length = 261 Score = 146 bits (368), Expect = 4e-40 Identities = 82/231 (35%), Positives = 130/231 (56%), Gaps = 7/231 (3%) Query: 9 LSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFLGQEIQ 68 L+ YG + +V + GEVV L+G NGAGKTT L GL++P +G+IE G+++ Sbjct: 29 LTKRYGKRTVLSEVDVHLRHGEVVGLLGPNGAGKTTCFYILVGLIQPDAGRIELAGRDVT 88 Query: 69 KMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKK----VFSRFP 124 + P GL +P+ +F LTV +NL+ A L+ R+ ++A ++ + F Sbjct: 89 RAPVHLRARLGLGYLPQEASIFRRLTVWQNLQ--AVLELRRDLDRAGRRETGDALIEEF- 145 Query: 125 RLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDIQK 184 +LE ++ LSGGE++ + RAL P+ + LDEP G+ PI + EI D+I +++ Sbjct: 146 QLETVRDSPGIALSGGERRRAEIARALAGNPQFVCLDEPFAGVDPISVVEIQDVIGHLKQ 205 Query: 185 QGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 +G VL+ + N + L I DR Y+L G+++ GT EL + VR YLG Sbjct: 206 RGIGVLISDHNVRETLGICDRAYILSEGRLLSEGTPAELLADHRVRTVYLG 256 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 261 Length adjustment: 24 Effective length of query: 212 Effective length of database: 237 Effective search space: 50244 Effective search space used: 50244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory