Align Probable 4-aminobutyrate aminotransferase; EC 2.6.1.19; (S)-3-amino-2-methylpropionate transaminase; EC 2.6.1.22; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT (uncharacterized)
to candidate WP_007473198.1 CMTB2_RS01140 aspartate aminotransferase family protein
Query= curated2:P94427 (436 letters) >NCBI__GCF_000170735.1:WP_007473198.1 Length = 393 Score = 190 bits (483), Expect = 6e-53 Identities = 134/408 (32%), Positives = 203/408 (49%), Gaps = 47/408 (11%) Query: 34 VKGEGAELYDLDGRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYI 93 ++GE A L+D + +IDF IG ++VGH + ++ A+ QA +IH N+ P Sbjct: 16 IRGENATLWDKNRNEYIDFTSGIGVVSVGHGNIRLSNAICDQARNIIHIS-NLYRIPPQK 74 Query: 94 ELAEKLCGIAPGSHEKKAIFLNSGAEAVENAVKIARKY------TKRQGVVSFTRGFHGR 147 ELAE L + + F NSGAEA E A+KIARKY KR V++ FHGR Sbjct: 75 ELAEIL--VKKSGIDGGVFFCNSGAEANETALKIARKYGEVNGEIKRYKVITLENSFHGR 132 Query: 148 TNMTMSMTSKVKPYKFGFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFFIAS 207 T T+ T + K + + FGPF P + Y K + DD I Sbjct: 133 TISTLKATGQPKFHTY-FGPF-------PDGFDYAKNIKDIENKIDDKTI---------- 174 Query: 208 VAPETVACVVMEPVQGEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAI 267 V++E +QGEGG K +Q++A F KE I+ + DE+QTG RTG + A Sbjct: 175 -------AVMIELIQGEGGVNPFDKEDIQNLAKFLKEKDILLIVDEVQTGIYRTGEFLAS 227 Query: 268 EHFDVVPDLITVSKSLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDI 327 +++ PD++T++K L G+P+ VI ++D PG+ G T+ G+ L A + V+ I Sbjct: 228 NLYEITPDIVTLAKGLGGGVPIGAVI--TSLVDVLKPGDHGSTFGGNYLSTRAGIEVIKI 285 Query: 328 IEEEGLNERSEEIGKIIEDKAYEWKQEFPFIGD-IRRLGAMAAIEIVKDPDTREPDKTKA 386 ++E + +EI + K E +EFP + D + G M A++ K E Sbjct: 286 LDEYYESGMLKEIINYFDSKLVEIAKEFPNLFDNVSGFGLMRALKTHKSEIRDE------ 339 Query: 387 AAIAAYANQNGLLLLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGL 434 I A + +L+L AG N +RFL PL I+ +NEG L++ + Sbjct: 340 --IVKKAFEEKVLVLKAG--NNAVRFLPPLTITKEEINEGFDRLKSAI 383 Lambda K H 0.319 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 393 Length adjustment: 31 Effective length of query: 405 Effective length of database: 362 Effective search space: 146610 Effective search space used: 146610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory