Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate WP_007473537.1 CMTB2_RS01995 long-chain fatty acid--CoA ligase
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >NCBI__GCF_000170735.1:WP_007473537.1 Length = 519 Score = 232 bits (591), Expect = 3e-65 Identities = 154/520 (29%), Positives = 268/520 (51%), Gaps = 47/520 (9%) Query: 55 RRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVNINPA 114 ++ ++ ++ + A L +G+ GD++ I+ +N+ E+V+ ++G V V IN Sbjct: 30 KKISWQDVKKKVDTFARTLELLGIKKGDKIPIYVNNSLEFVIALFGIQKIGAVPVPINTF 89 Query: 115 YRTAEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTVV 174 + E+ + LN + + L++ ++F+ + + +RE +K ++ Sbjct: 90 LKEDEISFILNDIEAEFLIASSKFEKN--IPNIREKT-----------------SVKKII 130 Query: 175 WIDDEAGQGADEPGLLRFTELIARGNAAD----PRLAQVAAGLQATDPINIQFTSGTTGF 230 W + + D + FTE+++ + P L +A I +TSGTTG Sbjct: 131 WEGEPSIIDEDN---ISFTEILSNIEPHESIEYPTLDDLAV---------IIYTSGTTGK 178 Query: 231 PKGATLTHRNILNNGFFIGECMKLTPADRLCIPVPLYHCFGMVLGNLACFTHGATIVYPN 290 PKGA LT++NI + + I E +K+TP DR +P++H F M + L G+ +V Sbjct: 179 PKGAMLTYKNIFADIWGINEIVKITPKDRFIAYLPMFHSFTMTVNILLPLYTGSAVVIIK 238 Query: 291 DGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPR----FAEFNLSTLRTGIMAGSPCPT 346 +++ +R T GVP ++ A L + F FN +R + + P Sbjct: 239 SIMPFSNIIKQTLLKRVTIFTGVPDVYSA-LSRAKLPFYFHWFN--KVRFYVSGAAALPG 295 Query: 347 EVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTPLSKRVSTVGQVQPHLEVKIVDPDT 406 EV++R ++ ++ YG++ETSPV + + P ++ +VG P +EVKIV+ D Sbjct: 296 EVLERFSKKFKKAKLLEGYGLSETSPVV---AVNRPYLQKPGSVGPAIPGVEVKIVN-DE 351 Query: 407 GAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDLATMDAEGYVNIVGRI 466 VPIG+ GE KG VM GY+ + E + G W TGD+ +D +G++ I+ R Sbjct: 352 LIEVPIGEAGEIIVKGDIVMKGYYNRDEANEECLING-WFLTGDIGKVDEDGFIYILDRK 410 Query: 467 KDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQPTEDDI 526 KD++I G NIYPREIEE + + P ++D VVG+ D+ +GE A+I + + E D+ Sbjct: 411 KDLIISKGVNIYPREIEEIILKFPGIKDCAVVGLKDENHGEIPVAFIEVEEDMEVNEKDL 470 Query: 527 RAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIRDEM 566 R + K ++A+YK+P+YI FV + P TGK+ K +R+ + Sbjct: 471 RKYLKSKLANYKLPKYIYFVENLPKNATGKVLKRILRENI 510 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 622 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 578 Length of database: 519 Length adjustment: 36 Effective length of query: 542 Effective length of database: 483 Effective search space: 261786 Effective search space used: 261786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory