Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate WP_007474515.1 CMTB2_RS05090 diaminopimelate epimerase
Query= curated2:A6Q160 (250 letters) >NCBI__GCF_000170735.1:WP_007474515.1 Length = 241 Score = 297 bits (760), Expect = 2e-85 Identities = 155/247 (62%), Positives = 185/247 (74%), Gaps = 7/247 (2%) Query: 1 MQLVKYSASGNDFVIYHTFVKKDRSELAKLLCHRHEGIGADGLIVLLPHSRYDFEWQFYN 60 M + KYSASGNDFVI+HTF KKDRS LAK LC R GIGADGLIVLLPH YDFEWQFYN Sbjct: 1 MFVCKYSASGNDFVIFHTFKKKDRSNLAKKLCDRFNGIGADGLIVLLPHKTYDFEWQFYN 60 Query: 61 ADGSEAEMCGNGSRAAAHYAYSYGLASKQMRFLTLAGVIEASVEADVVESQLTKPKILDR 120 ADGSEA MCGNGSRAAA YAY Y LAS +M+FLT AGVIEA V+ D+VE+QLT K L + Sbjct: 61 ADGSEASMCGNGSRAAALYAYKYDLASSKMKFLTGAGVIEAEVDGDIVETQLTPYKELGK 120 Query: 121 KIEENGKRWWLIDTGVPHLVTFVEDLNQFDKNESKRLRNKYNANVNYGIIRDLENVGVRT 180 E W L DTGVPHLV ++ L F+ NE + LR K+NANVN ++D + VRT Sbjct: 121 FDE-----WELFDTGVPHLVK-LDKLENFNINECRELRYKHNANVNIAEVKD-NKLFVRT 173 Query: 181 YERGVEDETLACGTGMAATFLRAFEEGVVNPTVTVVPKSGEELQLRYENEKLFFKGRVKK 240 YERGVEDETLACGTGM A+FL+A +EG++ ++ V PKS EEL++ + +L+FKGRVK+ Sbjct: 174 YERGVEDETLACGTGMCASFLKARKEGLIGDSIKVYPKSKEELEISLKRNRLYFKGRVKE 233 Query: 241 VFETFKE 247 F+ E Sbjct: 234 TFKALCE 240 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 241 Length adjustment: 24 Effective length of query: 226 Effective length of database: 217 Effective search space: 49042 Effective search space used: 49042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate WP_007474515.1 CMTB2_RS05090 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
../bin/blast/fastacmd -i /tmp/list.2657.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.2657.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.