Align tryptophan synthase subunit α (EC 4.1.2.8) (characterized)
to candidate WP_007475328.1 CMTB2_RS07715 tryptophan synthase subunit alpha
Query= metacyc::MONOMER-3561 (251 letters) >NCBI__GCF_000170735.1:WP_007475328.1 Length = 240 Score = 114 bits (286), Expect = 1e-30 Identities = 73/234 (31%), Positives = 123/234 (52%), Gaps = 12/234 (5%) Query: 7 LIPYLTAGDPSVEKTLEFLLAVEEFA-GLIELGIPFSDPMADGKTIQESHYRALRNGFKL 65 LI Y+T P E T++ + +++E IELGIPFSDP+ADG+ IQE + RAL+NG+K+ Sbjct: 4 LIAYITTAYPDKEFTIDLIHSLKENGVDGIELGIPFSDPVADGEIIQEVNKRALQNGYKI 63 Query: 66 DDTFRILREFRRHSSTPVILMTYYNPVFRTGVKKFLGEAKASGADGILVVDLPVSHAGEF 125 +DTF + + T M Y+N + G + +AK G ++ DLP A E+ Sbjct: 64 NDTFYVSEKTGNIIDT--YWMGYFNNFYHKGYNFMIEKAKEYNIKGFIIPDLPYEEAIEY 121 Query: 126 LDAAKEEGLKTVFLAAPNTPDERLREIDKASTGFVYLISLYGTTGARDRLPETAFEFVRR 185 E + AP ER++ I + F+YL++ G TG+ + E ++ Sbjct: 122 -----ENKFPLISFVAPTDSLERIKTILQNPKEFIYLVAYAGITGSDKK--EDLSNIIKY 174 Query: 186 ARKICNNKLAVGFGVSRREQVEELLKAGADGVVVGSALIELISRSENPVEELRR 239 ++I + L +GFGV+ E+ DGV+VGS ++++ + E++++ Sbjct: 175 IKEIISTPLYIGFGVNENTAREK--AKNVDGVIVGSTFVKVLLEDISNTEKIKK 226 Lambda K H 0.319 0.138 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 240 Length adjustment: 24 Effective length of query: 227 Effective length of database: 216 Effective search space: 49032 Effective search space used: 49032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate WP_007475328.1 CMTB2_RS07715 (tryptophan synthase subunit alpha)
to HMM TIGR00262 (trpA: tryptophan synthase, alpha subunit (EC 4.2.1.20))
../bin/blast/fastacmd -i /tmp/list.22045.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.22045.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.