Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_007475415.1 CMTB2_RS07935 ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >NCBI__GCF_000170735.1:WP_007475415.1 Length = 253 Score = 110 bits (276), Expect = 2e-29 Identities = 76/251 (30%), Positives = 135/251 (53%), Gaps = 14/251 (5%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 ++++ L K +G VLK V+L G + I+G SG GKST ++ I L +P AG+I ++ Sbjct: 2 IKIRHLKKVFGQKVVLKDVNLDIYDGKITYILGMSGQGKSTIIKHIVGLLKPTAGEIWVD 61 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 + VAN AD + L ++R ++ FQ L+ M +N+ +SK Sbjct: 62 DVN---VAN-------ADIQTLYKIRKKVGFTFQEGALFDSMNIFDNVAFPLKEHTKLSK 111 Query: 124 TEAREKAEHYLNKVGVAHRKDAY--PGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALD 181 E +++ L VG+ + AY P +SGG ++R A ARA+ ++P+ +L+DEPTS LD Sbjct: 112 EEIKKRVFETLEMVGLDANRVAYLYPHELSGGMRKRAATARAIILKPKYVLYDEPTSGLD 171 Query: 182 PELVGDVLKVMQAL-AQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNP 240 P + + +++ L T VV++H++ + ++ + L++G + E G+ E N Sbjct: 172 PIISDKITRMIIDLNKNHNMTSVVISHDLKETFKSADYIAMLYQGEIIEFGSVEE-FKNS 230 Query: 241 QSERLQQFLSG 251 ++ +Q F+ G Sbjct: 231 KNPIVQAFIRG 241 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory