GapMind for catabolism of small carbon sources

 

Protein WP_008805157.1 in Klebsiella variicola At-22

Annotation: NCBI__GCF_000025465.1:WP_008805157.1

Length: 458 amino acids

Source: GCF_000025465.1 in NCBI

Candidate for 9 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-phenylalanine catabolism aroP hi Aromatic amino acid transport protein AroP (characterized, see rationale) 79% 97% 711.1 L-tyrosine transporter 62% 590.5
L-tryptophan catabolism aroP hi Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) 73% 100% 684.1 Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs 65% 615.1
L-tyrosine catabolism aroP hi Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) 73% 100% 684.1 Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs 65% 615.1
phenylacetate catabolism H281DRAFT_04042 med Aromatic amino acid transporter AroP (characterized, see rationale) 68% 98% 647.1 Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan 73% 684.1
L-threonine catabolism RR42_RS28305 med D-serine/D-alanine/glycine transporter (characterized, see rationale) 44% 95% 419.1 Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan 73% 684.1
L-proline catabolism proY med Proline-specific permease (ProY) (characterized) 45% 98% 398.3 Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan 73% 684.1
L-histidine catabolism permease med histidine permease (characterized) 44% 97% 392.5 Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan 73% 684.1
D-serine catabolism cycA lo D-serine/D-alanine/glycine transporter (characterized) 40% 96% 360.9 Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan 73% 684.1
L-asparagine catabolism ansP lo L-asparagine permease; L-asparagine transport protein (characterized) 36% 91% 325.9 Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan 73% 684.1

Sequence Analysis Tools

View WP_008805157.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTTQQEHQLKRGLKNRHIQLIALGGAVGTGLFLGIAQTIRMAGPSVLLGYAIAGAIAFFI
MRQLGEMVVEEPVAGSFSHFANRYWGPFAGFMSGWNYWVLYVLVSMAELTAVGIYIQYWW
PEVPAWLSAAIFFVAINAINLTNVKVYGELEFWFSIVKVAAIISMIAFGSYLLFSGHGGP
AATVANLWQDGGFFPNGITGLVMAMAVIMFSFGGLELVGITAAEADEPHKTIPKATNQVI
YRILLFYVGSLAVLLSLYPWRNVVEGGSPFVLIFHAIDSNIVANALNLVVLTAALSVYNS
CVYCNSRMLFGLAQQGNAPRALLRVNRRGIPLTALAVSAVATALCVVINYVMPGKAFGLL
MALVVAALVINWAMICITHLKFRRAMQRAGKVTAFQSLGYPLTNWLCLLFLAGILVVMYL
TPDIRISVCLIPVWLLILAAGYLLRKKSAPALVAMKEG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory