Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_009545413.1 CCE_RS16150 ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_000017845.1:WP_009545413.1 Length = 257 Score = 364 bits (935), Expect = e-106 Identities = 181/250 (72%), Positives = 211/250 (84%) Query: 11 LLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIF 70 +L A L KSFGG+KAV A+I+V QGSITGLIGPNGAGKTTLFNLL NFIRPD+G V+F Sbjct: 8 ILDAKQLSKSFGGLKAVDNAQIQVKQGSITGLIGPNGAGKTTLFNLLCNFIRPDQGEVMF 67 Query: 71 DGEPIQQLQPHQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQPQVVV 130 DGEPIQ L PH+IA QG +RTFQVAR LSRL+VL+NMLLA QKQTGENF Q+ L+ + Sbjct: 68 DGEPIQHLSPHKIALQGCIRTFQVARVLSRLTVLDNMLLATQKQTGENFLQLWLKRGQIK 127 Query: 131 KEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEPAAGV 190 +EE++ +E+A+ +LESVGL +K ++YAG LSGGQRKLLEM R LMT PKLILLDEPAAGV Sbjct: 128 QEERENKEKALSILESVGLIEKRHDYAGALSGGQRKLLEMARTLMTRPKLILLDEPAAGV 187 Query: 191 NPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPAEIQTN 250 NP LI IC+ I+TWN+Q G++FLIIEHNMDV+MSLCD VWVLAEG NLADGTP EIQ N Sbjct: 188 NPTLIGQICEHIITWNKQQGISFLIIEHNMDVVMSLCDHVWVLAEGTNLADGTPTEIQQN 247 Query: 251 SQVLEAYLGK 260 S VLEAYLG+ Sbjct: 248 STVLEAYLGE 257 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory