Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_009547405.1 CCE_RS13905 branched-chain amino acid ABC transporter permease
Query= TCDB::P74318 (286 letters) >NCBI__GCF_000017845.1:WP_009547405.1 Length = 294 Score = 424 bits (1089), Expect = e-123 Identities = 203/283 (71%), Positives = 245/283 (86%), Gaps = 1/283 (0%) Query: 4 SQLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTSGINLWLSM 63 +Q +F+G+A+GS+IAL AVGLTLTYGILRLSNFAHGDFMTL AYLTW ANT G+NL LS+ Sbjct: 11 AQNLFDGLAIGSVIALAAVGLTLTYGILRLSNFAHGDFMTLGAYLTWLANTQGLNLGLSV 70 Query: 64 ALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNNQNYRV 123 +G +GT++AM + E+LLWKPMR RRAT+TTLIIISIGLALFLRNGIL+IWG NQ Y + Sbjct: 71 IIGAMGTVLAMLVSEYLLWKPMRDRRATSTTLIIISIGLALFLRNGILMIWGAKNQRYDI 130 Query: 124 PIVPAQDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDLAKVSGIN 183 P+V AQ G++ R+ I ++I A+ +LHL+LQ TK+GKAMRAVADN+DLA+VSGIN Sbjct: 131 PLVQAQKLFGLQLATDRIWAIILSIVAIAILHLVLQNTKIGKAMRAVADNIDLARVSGIN 190 Query: 184 VEWVVMWTWVMTAVLTALGGSMYGLMT-TLKPNMGWFLILPMFASVILGGIGNPYGAIAG 242 VE VV+WTWV+TA+LT LGG M GL+T T++PNMGWFLILPMFASVILGGIGNPYGAIAG Sbjct: 191 VEQVVLWTWVITAILTTLGGVMLGLITSTVRPNMGWFLILPMFASVILGGIGNPYGAIAG 250 Query: 243 GIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGLFKGT 285 G++IGVAQE+SVPW G YK+GVALL+MI+IL IRPQG+FKGT Sbjct: 251 GLVIGVAQELSVPWLGPDYKLGVALLIMILILLIRPQGIFKGT 293 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 294 Length adjustment: 26 Effective length of query: 260 Effective length of database: 268 Effective search space: 69680 Effective search space used: 69680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory