Align NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_009547477.1 CCE_RS14940 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YY08 (377 letters) >NCBI__GCF_000017845.1:WP_009547477.1 Length = 382 Score = 414 bits (1063), Expect = e-120 Identities = 209/375 (55%), Positives = 282/375 (75%), Gaps = 8/375 (2%) Query: 4 YLIFLAISTATFALFSLGLNLQWGFTGLINFGHIAFMTLGAYTTVLLSLKGVPLFISAIV 63 Y+I++ S + +F+LGLNLQWGFTGLINFG + FMTLGAYT+VLL+L GVP ++ + Sbjct: 15 YIIYITTSAGVYGIFALGLNLQWGFTGLINFGVVGFMTLGAYTSVLLTLTGVPFVLAVLA 74 Query: 64 GAIFAALLGLVIGFATLRLREDYLAIVTIGTGELIRLVVNNQDLPVGDTWVS-GAFGVQS 122 GAI AA+LGL+IG +TLRLREDYLAIVTIG EL+RLV N++ W++ GA G++ Sbjct: 75 GAILAAILGLLIGLSTLRLREDYLAIVTIGVSELVRLVALNEE------WLTKGALGLRQ 128 Query: 123 YPIPLSTEPNLFFRLLMIGILTLLFAVTVFSLWRWIRNAQKLQLTDATDKTSSKQEIASR 182 YP+PL+ E +L +I ILT+L ++L++ + + K Q + K+ ++ S Sbjct: 129 YPLPLNIEATFPIKLSLIAILTILAIYAEWTLYKSLIDEWK-QNKEIQGKSYQPRKPLSL 187 Query: 183 FGVGIILGLLATAIYISGVITLYNYIPKAGLMLVSLLVLAFVFWRLEYLVRSPWGRVLKA 242 G+I L +YI+G+ +L Y KAGLM++ LL+LA + LE+LV SPWGR+LKA Sbjct: 188 IIWGVIATTLILLVYITGITSLSFYTYKAGLMVLVLLILALTYGCLEFLVNSPWGRILKA 247 Query: 243 IREDEEIPKAMGKNVFWYKLQSLMLGGAIAGIAGAFFAWQISAIYPDNFQPQLTFDSWIM 302 IREDEEIP+A+GKNV YKLQS MLGGAIAGIAGAFFAWQ++ IYPD F P +TF++WI+ Sbjct: 248 IREDEEIPRALGKNVLLYKLQSFMLGGAIAGIAGAFFAWQLTTIYPDKFDPLITFNTWII 307 Query: 303 VILGGAGNNIGSILGAVIYFAYDAITREVLPKIIPLDEARLGAFRIMCIGLILMVLMIWR 362 V+LGG+G+N G+ILGA+I++AYD++TR +LP++ L ++ G FRIM IGLILM+LM+WR Sbjct: 308 VVLGGSGSNAGTILGAIIFWAYDSLTRFLLPQLGILSPSQAGYFRIMIIGLILMILMVWR 367 Query: 363 PQGILGKKEELTLGK 377 PQGILGKKEELTLG+ Sbjct: 368 PQGILGKKEELTLGR 382 Lambda K H 0.328 0.145 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 603 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 382 Length adjustment: 30 Effective length of query: 347 Effective length of database: 352 Effective search space: 122144 Effective search space used: 122144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory