Align ABC transporter for D-Alanine, periplasmic substrate-binding component (characterized)
to candidate WP_009563564.1 RSPH17029_RS18145 amino acid ABC transporter substrate-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5402 (343 letters) >NCBI__GCF_000015985.1:WP_009563564.1 Length = 345 Score = 307 bits (787), Expect = 2e-88 Identities = 159/338 (47%), Positives = 215/338 (63%), Gaps = 4/338 (1%) Query: 6 STLAVMTAAAVLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDSTGKIVGIDADF 65 S LA + A G + FAQ+G TL AV+++G V CGV GF+ PDS GK G + DF Sbjct: 10 SVLAALLLAGA-GTAAFAQSGDTLAAVKERGEVLCGVHPARHGFAAPDSQGKWSGFEVDF 68 Query: 66 CRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDMLSRNSTMTSSRDAGMGLKFPGFIT 125 C A+AAAVFGDA KV+F L++++RF A+QSGE+D+L+RN T T SRD +GL F I Sbjct: 69 CHAIAAAVFGDANKVRFVALSSQQRFPAIQSGEVDVLARNVTATLSRDTALGLNFAPPI- 127 Query: 126 YYDGIGFLANNKLGVKSAKELDGATICIQAGTTTELNVSDYFRANGLKYTPITFDTSDES 185 +Y G GFL G++ ++LDGA IC+ G+TTE NV+ F A GL YTP+ + + + Sbjct: 128 FYTGTGFLVRAADGIEKVEDLDGAAICMAPGSTTERNVAQIFAARGLSYTPVVIENNKQL 187 Query: 186 AKSLESGRCDVLTSDKSQLFAQRS-KLASPKDYVVLPETISKEPLGPVVRNGDDEWLAIV 244 + +GRCD LT DK+ L R+ P D+V+LP SKEPL VR GDD+W +V Sbjct: 188 VDAYVTGRCDALTKDKAALPGVRAFDTEVPGDHVLLPGIYSKEPLAMAVRQGDDKWYDLV 247 Query: 245 RWTGYALLNAEEAGVTSKNVEAEAKSTKNPDVARMLGADGEYGKDLKLPKDWVVQIVKQV 304 +W YA NAEE GVT NV+ E K++ +PD+ +LG G+ G L +P DW IVKQV Sbjct: 248 KWVTYATFNAEELGVTQANVD-EMKASDDPDIQTLLGVIGDNGTKLGVPNDWAYAIVKQV 306 Query: 305 GNYGEMFERNLGKGTPLEIDRGLNALWNAGGIQYAPPV 342 GNY +++ R+ G TP+ +DR N LW GG+ Y P+ Sbjct: 307 GNYEDIYMRHFGPDTPVALDRDQNQLWTEGGLLYGFPM 344 Lambda K H 0.315 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 345 Length adjustment: 29 Effective length of query: 314 Effective length of database: 316 Effective search space: 99224 Effective search space used: 99224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory