Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate WP_009566244.1 RSPH17029_RS09145 SDR family oxidoreductase
Query= SwissProt::Q8P3K4 (300 letters) >NCBI__GCF_000015985.1:WP_009566244.1 Length = 246 Score = 305 bits (782), Expect = 5e-88 Identities = 153/245 (62%), Positives = 189/245 (77%), Gaps = 3/245 (1%) Query: 56 RLQGKRCLITAAGAGIGRESALACARAGAHVIATDIDAAALQALAAESDAITTQLLDVTD 115 RL+GKR L+TAAG GIGR SALA AR GA V+ATD++AAAL+ LAAE + Q LDV D Sbjct: 4 RLEGKRALVTAAGQGIGRASALAMAREGARVLATDLNAAALEGLAAEG--LEVQPLDVRD 61 Query: 116 AAAITALVAAHGPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTCKAVLPGML 175 A+I A VAA GP DVLFNCAG+V G+ILDCDE W S +N+ MY C+A LPGM+ Sbjct: 62 PASIAAAVAAAGPLDVLFNCAGFVASGTILDCDEEDWAFSVGLNLTGMYRMCRAFLPGMI 121 Query: 176 ERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNAICPGTIK 235 G GSIINM+SV S+ PNRFVYG TKA V+GL+K+IAAD++ QG+RCNAICPGT++ Sbjct: 122 AGGGGSIINMASVVSAAIAAPNRFVYGTTKAGVVGLTKSIAADFIGQGIRCNAICPGTVE 181 Query: 236 TPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFTTGQTHIID 295 +PSL +R++A GD +A ++F RQP+GR+G P EIA LVVYLASDES++TTG H+ID Sbjct: 182 SPSLEERLRAT-GDYEAARRAFVARQPIGRIGRPEEIAALVVYLASDESAYTTGVAHVID 240 Query: 296 GGWSN 300 GGWSN Sbjct: 241 GGWSN 245 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 246 Length adjustment: 25 Effective length of query: 275 Effective length of database: 221 Effective search space: 60775 Effective search space used: 60775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory