Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; EC 2.3.1.9 (characterized)
to candidate WP_010626093.1 BZY95_RS06835 3-oxoadipyl-CoA thiolase
Query= SwissProt::Q0AVM3 (396 letters) >NCBI__GCF_002151265.1:WP_010626093.1 Length = 401 Score = 342 bits (877), Expect = 1e-98 Identities = 182/403 (45%), Positives = 263/403 (65%), Gaps = 12/403 (2%) Query: 3 REVVLVGACRTPVGTFGGTLKDVGSAQLGAIVMGEAIKR-AGIKAEQIDEVIFGCVLQAG 61 ++ +++ A RTP+G +GG L V + LGA+ + + R + Q+D++ +GC QAG Sbjct: 2 KDALIIDAIRTPIGRYGGALASVRADDLGAVPLRALMARHPSLDWRQVDDIFYGCANQAG 61 Query: 62 L-GQNVARQCMINAGIPKEVTAFTINKVCGSGLRAVSLAAQVIKAGDADIIMAGGTENMD 120 +NVAR + AG+P EV T N++CGSGL AV AA+ IK G+A +++AGG E+M Sbjct: 62 EDNRNVARMSALLAGLPVEVPGTTFNRLCGSGLDAVGNAARAIKTGEAGLMIAGGVESMS 121 Query: 121 KAPFILPNARWGYRMSMPKGDLIDEMVWGGLTDVFNGYHMGI-----TAENINDMYGITR 175 +APF++ A + S ++ D + + GI TAEN+ + + I+R Sbjct: 122 RAPFVMGKAEQAFSRS---AEIFDTTIGWRFVNRQMKAQFGIDSMPETAENVAEQFAISR 178 Query: 176 EEQDAFGFRSQTLAAQAIESGRFKDEIVPV-VIKGKKGDIVFDTDEHPRKSTP-EAMAKL 233 E+QD F RSQ A A+E+GR EIVPV V + K+ +V DTDEHPR +T E +A L Sbjct: 179 EDQDLFALRSQQRTAAAMEAGRLAAEIVPVEVARRKQAPLVVDTDEHPRAATTLEQLAGL 238 Query: 234 APAFKKGGSVTAGNASGINDAAAAVIVMSKEKADELGIKPMAKVVSYASGGVDPSVMGLG 293 F++ GSVTAGNASG+ND A A+++ S E+A+ G++P A+VV A+ GV+P +MG G Sbjct: 239 PTPFREDGSVTAGNASGVNDGACALLLASAEQAERFGLEPRARVVGMATVGVEPRIMGFG 298 Query: 294 PIPASRKALEKAGLTIDDIDLIEANEAFAAQSIAVARDLGWADKMEKVNVNGGAIAIGHP 353 P PA+RK L + GL+++ +D+IE NEAFAAQ++AV R+LG D E VN NGGAIA+GHP Sbjct: 299 PAPATRKVLTQTGLSLEQMDVIELNEAFAAQALAVTRNLGLPDDAEHVNPNGGAIALGHP 358 Query: 354 IGSSGARILVTLLYEMQKRGSKKGLATLCIGGGMGTALIVEAL 396 +G SGAR++ T LYE+++R + L T+CIG G G ALI+E L Sbjct: 359 LGMSGARLVTTALYELERRQGRYALCTMCIGVGQGIALIIERL 401 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 401 Length adjustment: 31 Effective length of query: 365 Effective length of database: 370 Effective search space: 135050 Effective search space used: 135050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory