Align small component of L-lactate and L-malate uptake system (characterized)
to candidate WP_010629690.1 BZY95_RS03240 DUF4212 domain-containing protein
Query= reanno::PV4:5209924 (88 letters) >NCBI__GCF_002151265.1:WP_010629690.1 Length = 86 Score = 83.6 bits (205), Expect = 4e-22 Identities = 37/79 (46%), Positives = 52/79 (65%) Query: 9 AEGYWRENLRLVLGLLAIWAAVSFGCGILLVDVLNEIHFMGFKLGFWFAQQGAMYVFVAL 68 A YW+ N+RL+ G + +WA VS+GC +L +L+ I G LGFWFAQQG++ F+ L Sbjct: 8 AAEYWKANVRLITGCMIVWAFVSYGCAMLFRPLLSGIPIGGTDLGFWFAQQGSILTFIGL 67 Query: 69 IFVYVAKANALDKKYNVHE 87 IF Y K N LD+K+ + E Sbjct: 68 IFFYAWKMNKLDQKFGLGE 86 Lambda K H 0.329 0.143 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 47 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 88 Length of database: 86 Length adjustment: 9 Effective length of query: 79 Effective length of database: 77 Effective search space: 6083 Effective search space used: 6083 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (20.8 bits) S2: 38 (19.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory