GapMind for catabolism of small carbon sources

 

Alignments for a candidate for Shew_2732 in Halomonas desiderata SP1

Align small component of L-lactate and L-malate uptake system (characterized)
to candidate WP_010629690.1 BZY95_RS03240 DUF4212 domain-containing protein

Query= reanno::PV4:5209924
         (88 letters)



>NCBI__GCF_002151265.1:WP_010629690.1
          Length = 86

 Score = 83.6 bits (205), Expect = 4e-22
 Identities = 37/79 (46%), Positives = 52/79 (65%)

Query: 9  AEGYWRENLRLVLGLLAIWAAVSFGCGILLVDVLNEIHFMGFKLGFWFAQQGAMYVFVAL 68
          A  YW+ N+RL+ G + +WA VS+GC +L   +L+ I   G  LGFWFAQQG++  F+ L
Sbjct: 8  AAEYWKANVRLITGCMIVWAFVSYGCAMLFRPLLSGIPIGGTDLGFWFAQQGSILTFIGL 67

Query: 69 IFVYVAKANALDKKYNVHE 87
          IF Y  K N LD+K+ + E
Sbjct: 68 IFFYAWKMNKLDQKFGLGE 86


Lambda     K      H
   0.329    0.143    0.455 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 47
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 88
Length of database: 86
Length adjustment: 9
Effective length of query: 79
Effective length of database: 77
Effective search space:     6083
Effective search space used:     6083
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (20.8 bits)
S2: 38 (19.2 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory