Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_010959388.1 MCA_RS00075 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::Korea:Ga0059261_1644 (347 letters) >NCBI__GCF_000008325.1:WP_010959388.1 Length = 610 Score = 135 bits (341), Expect = 2e-36 Identities = 103/324 (31%), Positives = 156/324 (48%), Gaps = 21/324 (6%) Query: 37 ERVAARLRASPPAVVVTCARGSSDHAATYAKYLIETLTGVPTASAALSVASLYDAPVAPG 96 ER A +V C G+S HA A+Y E L G+P + S V PG Sbjct: 285 ERAEAAFEHVRAVQIVAC--GTSYHAGKVARYWFEALAGLPCSVEVASEFRYRRQVVQPG 342 Query: 97 NGLCLAISQSGKSPDLLATVEHQRKAG-AFVVAMVNAEDSPLAALADIVIPLKAGPERSV 155 L + ISQSG++ D LA ++ ++ G A +A+ N +S + +D + +AGPE V Sbjct: 343 T-LFVTISQSGETADTLAALKAAKELGYAHTLAICNVPESSIVRESDSCLMTRAGPEIGV 401 Query: 156 AATKSYICSLAAIAALVAAWAQDEALETA--------VADLPAQLERAFAL-DWSAAVTA 206 A+TK++ L A+ LV A + AL + LPAQ+ L D AA Sbjct: 402 ASTKAFTTQLTALLLLVLALGRRHALAAEQEAKIVRELETLPAQIRHVLQLEDEIAAWAE 461 Query: 207 LTGASG-LFVLGRGYGYGIAQEAALKFKETCALHAESFSAAEVRHGPMAIVGEAFHVLAF 265 L G LGRG Y +A E ALK KE +HAE++ A E++HGP+A++ V+A Sbjct: 462 LFGEKHHALYLGRGAQYPVAMEGALKLKEISYIHAEAYPAGELKHGPLALIDNEMPVVAV 521 Query: 266 ASSDRAGESVRETVAEFRSRGAEV-LLADPAARQAGLPAI------AAHPAIEPILIVQS 318 A ++ E ++ + E ++RG E+ + AD A +P + + PI+ Sbjct: 522 APNNELLEKLKSNLQEVQARGGELYVFADAEAPIENVPGVRILRVAETDEVVAPIVYSVP 581 Query: 319 FYKMANALALARGCDPDSPPHLNK 342 +A +AL +G D D P +L K Sbjct: 582 LQLLAYHVALIKGTDVDQPRNLAK 605 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 610 Length adjustment: 33 Effective length of query: 314 Effective length of database: 577 Effective search space: 181178 Effective search space used: 181178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory