Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate WP_010959390.1 MCA_RS00085 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= reanno::Putida:PP_4108 (416 letters) >NCBI__GCF_000008325.1:WP_010959390.1 Length = 451 Score = 165 bits (417), Expect = 3e-45 Identities = 136/419 (32%), Positives = 192/419 (45%), Gaps = 34/419 (8%) Query: 16 ITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHG 75 I + G + D DG+RY+D + V GHC+PA+ A+ Q RL H F H Sbjct: 32 IPIRRGEGVWLEDFDGRRYLDAISSWWVNLFGHCHPAINAALADQLGRLEHVIFAGFSHE 91 Query: 76 PYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVA------RGATGKRAIIAFDGGF 129 P + L E+L P ++G+ A E ALK++ RG GK + + + Sbjct: 92 PGIRLAERLVDITPPGLERC-FYADNGSAAVEVALKMSFHYWRNRGRPGKTRFVTLENSY 150 Query: 130 HGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAV- 188 HG TL L + G V YK+ L P P A E +R F LA+ Sbjct: 151 HGETLGALAV-GDVPLYKETYRPLLMEAVAAPSPDAYGREPGETEAGYAERRFRDMLAIL 209 Query: 189 ----EDVAAFIFEP-VQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRF 243 +++ A I EP VQ GG DP + + LR CD GI +I DEI GFGRTG F Sbjct: 210 ERGADEICAVIVEPLVQCAGGMRMYDPLYLRLLRAACDRLGIHLIADEIAVGFGRTGTLF 269 Query: 244 AFPRLGIEPDLLLLAKSIAGG-MPLGAVVGRKELMAAL--PKGGL-----GGTYSGNPIS 295 A + GI PD L L+K + GG +PL AV+ R E+ AA G L +Y+GNP++ Sbjct: 270 ACEQAGISPDFLCLSKGLTGGYLPLAAVLTRPEIYAAFYDDYGTLKAFLHSHSYTGNPLA 329 Query: 296 CAAALASLAQMTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFA-- 353 C AALA+L ++ + + ER++ P++ + G + IE Sbjct: 330 CRAALATLELFDATDVLGRNRELARCMADATERFQE---HPHVAEVRQRGMILAIEMVKD 386 Query: 354 NADGSPAPAQL---AKVMEAARARGLLLMPSGKARHII--RLLAP--LTIEAEVLEEGL 405 P P Q +V A RG+LL P G + + L+ P + + AEV EGL Sbjct: 387 KTTREPYPWQERRGLRVYRRALERGVLLRPLGNVIYFMPPYLITPEQIRLMAEVAWEGL 445 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 451 Length adjustment: 32 Effective length of query: 384 Effective length of database: 419 Effective search space: 160896 Effective search space used: 160896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory