Align Probable 5-dehydro-4-deoxyglucarate dehydratase; EC 4.2.1.41; 5-keto-4-deoxy-glucarate dehydratase; KDGDH (uncharacterized)
to candidate WP_010960012.1 MCA_RS03315 4-hydroxy-tetrahydrodipicolinate synthase
Query= curated2:B1W1P9 (320 letters) >NCBI__GCF_000008325.1:WP_010960012.1 Length = 291 Score = 100 bits (248), Expect = 6e-26 Identities = 78/242 (32%), Positives = 114/242 (47%), Gaps = 18/242 (7%) Query: 13 VAGPLFFPVTAFGPDGAVDLAVFRAHVRAGIDAGAAAVFACCGTGEFHALTPEEFRLAVG 72 + G + T PDG +D+ R V I+ G A+ A TGE L EE + Sbjct: 2 IQGSIVALATPMEPDGRLDVPGLRRLVEFHIEQGTDAIVAVGTTGESATLDEEEHTEVIR 61 Query: 73 AAVEESAGQVPVLAGAG-YGTALAVQYARAAEEAGADGLLAMPPYLVVADQQGLLHHYAA 131 VE++AG++PV+AG G T A++ A+ GAD L + PY Q+GL HY A Sbjct: 62 LVVEQAAGRIPVIAGTGANATTEAIRLTARAKAVGADACLLVTPYYNKPTQEGLYRHYLA 121 Query: 132 LAAATGLETIVYQ---RDNAVFTPETVVALARTPGVIGLKDGHGDLDLMQRIVSAVRTHR 188 +A A + I+Y R P TV LA+ PG++G+K+ G L+ + + +R Sbjct: 122 VAEAVDIPQILYNVPGRTGCDMLPATVGRLAQVPGIVGIKEATGKLERL----AEIRALC 177 Query: 189 PGGDFLYFNGLPTA---ELTGPAYRGIGVTLYSSAVFAFAPDIALAFYRALDSGDDALVD 245 P G LY TA L+G G GV ++ V AP + RA +GD A + Sbjct: 178 PEGFALYSGDDATACEFCLSG----GNGVISVTANV---APRLMQEMCRAAIAGDRATAE 230 Query: 246 GL 247 + Sbjct: 231 AI 232 Lambda K H 0.322 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 291 Length adjustment: 27 Effective length of query: 293 Effective length of database: 264 Effective search space: 77352 Effective search space used: 77352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory