Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_010960134.1 MCA_RS04000 aspartate aminotransferase family protein
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_000008325.1:WP_010960134.1 Length = 462 Score = 194 bits (494), Expect = 4e-54 Identities = 138/434 (31%), Positives = 215/434 (49%), Gaps = 70/434 (16%) Query: 39 VIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFYEN 98 V R +G +YD + D SG GV +G +HP+VV A+K + L D + Sbjct: 40 VYVRAQGPYLYDDQDREYLDLLSGFGVFALGRNHPQVVGALKDVLDA----QLPDLVQMD 95 Query: 99 AIILA----EKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGR 154 +L+ EK+++ PGD+ R + Y NSGAEA EAA+K +Y T R++ + H FHG Sbjct: 96 VSLLSGLLSEKILQRCPGDLSR-MFYCNSGAEAVEAAIKFARYTTKREKIVYCEHGFHGL 154 Query: 155 TQAVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEY 214 T LSL + V +DGF P +P +P+ N G E Sbjct: 155 TLGALSLNGEQ-VFRDGFGPLLPACKAVPF-----NDLGA-----------------LEA 191 Query: 215 VFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGK 274 RH +++ A EPIQG+G +P +G+ + ++G L DE+Q GIGRTGK Sbjct: 192 ALRH---NDVAAFIVEPIQGKG-VNLPDEGYLAEAARLCRKHGALFVADEIQTGIGRTGK 247 Query: 275 FWAIEHFGVEPDLIQFGKAIGGGLPLAGVI----HRADITFDKPGR---HATTFGGNPVA 327 FWAIEH+GVEPD+I KA+ GG G + H + F++ R H +TF N +A Sbjct: 248 FWAIEHWGVEPDMILMAKALSGGFIPVGAVAMKKHIMEAVFNRMDRAVVHGSTFSKNNMA 307 Query: 328 IAAGIEVVEIVKE--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEI--VKS 383 +AAGI +E++ E L+ + ++G+ + + ++YE++ RG G+ AVE KS Sbjct: 308 MAAGIATLEVLAEERLVENAAKLGEQIISGIRAMTDRYELLHAVRGKGMMIAVEFGAPKS 367 Query: 384 KETKEKYPELRDRIVKESAKRGLV-----------------LLGCGDNSIRFIPPLIVTK 426 K + L E+A +GL + G G N ++F+PPL++ + Sbjct: 368 FSLKAAWSLL------ETANKGLFSQMITIPLFKNHRILSQVAGHGMNVVKFLPPLVIGQ 421 Query: 427 EEIDVAMEIFEEAL 440 + D ++ + + Sbjct: 422 RDADWILQAMDTVI 435 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 25 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 462 Length adjustment: 33 Effective length of query: 412 Effective length of database: 429 Effective search space: 176748 Effective search space used: 176748 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory