Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate WP_010960134.1 MCA_RS04000 aspartate aminotransferase family protein
Query= SwissProt::P50457 (421 letters) >NCBI__GCF_000008325.1:WP_010960134.1 Length = 462 Score = 178 bits (451), Expect = 3e-49 Identities = 131/412 (31%), Positives = 206/412 (50%), Gaps = 37/412 (8%) Query: 29 AENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTL 88 A+ L D + EY+D +G V G HP +V A++ L Q+ L Sbjct: 44 AQGPYLYDDQDREYLDLLSGFGVFALGRNHPQVVGALKDVLDAQLPDLVQMDVSLLSGLL 103 Query: 89 AEKINALAPVSGQAKTAFF-TTGAEAVENAVKIARAHTGRPGVIAFSGGFHGRTYMTMAL 147 +EKI P G F+ +GAEAVE A+K AR T R ++ GFHG T ++L Sbjct: 104 SEKILQRCP--GDLSRMFYCNSGAEAVEAAIKFARYTTKREKIVYCEHGFHGLTLGALSL 161 Query: 148 TGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAIIFEPV 207 G+ ++ GFGP + VP+ + L A+E + + VAA I EP+ Sbjct: 162 NGEQV-FRDGFGPLLPACKAVPF----------NDLGALEAALRHN----DVAAFIVEPI 206 Query: 208 QGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLMTMAK 267 QG+G N+ + +A RLC +HG + +ADE+Q+G RTGK +A++H+ +PD++ MAK Sbjct: 207 QGKG-VNLPDEGYLAEAARLCRKHGALFVADEIQTGIGRTGKFWAIEHWGVEPDMILMAK 265 Query: 268 SLAGG-MPLSGVVGNANIMDA-----PAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCE 321 +L+GG +P+ V +IM+A G T++ N +A+AA A L ++ +E L E Sbjct: 266 ALSGGFIPVGAVAMKKHIMEAVFNRMDRAVVHGSTFSKNNMAMAAGIATLEVLAEERLVE 325 Query: 322 RANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAA-----------I 370 A +LG+++ + + + + AVRG G MIAVEF P++ AA Sbjct: 326 NAAKLGEQIISGIRAMTDRYELLHAVRGKGMMIAVEFGAPKSFSLKAAWSLLETANKGLF 385 Query: 371 AQKIQQRALAQGLLLLTCGAYG-NVIRFLYPLTIPDAQFDAAMKILQDALSD 421 +Q I +L +G NV++FL PL I D ++ + ++D Sbjct: 386 SQMITIPLFKNHRILSQVAGHGMNVVKFLPPLVIGQRDADWILQAMDTVIAD 437 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 462 Length adjustment: 32 Effective length of query: 389 Effective length of database: 430 Effective search space: 167270 Effective search space used: 167270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory