Align spermidine/putrescine ABC transporter, permease protein PotC (characterized)
to candidate WP_010960190.1 MCA_RS04285 spermidine/putrescine ABC transporter permease PotC
Query= CharProtDB::CH_088340 (264 letters) >NCBI__GCF_000008325.1:WP_010960190.1 Length = 270 Score = 301 bits (771), Expect = 1e-86 Identities = 141/243 (58%), Positives = 200/243 (82%), Gaps = 1/243 (0%) Query: 14 IYAYLYIPIIILIVNSFNSSRFGINWQGFTTKWYSLLMNNDSLLQAAQHSLTMAVFSATF 73 IYA+LY+P+ +LI+ SFN+S++GI WQGFT WY L N+ +L AA++SL +A SA+ Sbjct: 27 IYAFLYLPMAVLILGSFNASKYGIGWQGFTLDWYENLANDAEILAAARNSLAVAALSASL 86 Query: 74 ATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFMLLGIQLGFWSLLF 133 AT++G+L AV L+RYRFRG+ F+ G+LFV +MSPDIVMA+SLLVLF+ L ++LG ++L Sbjct: 87 ATVVGTLGAVGLHRYRFRGRKFLMGLLFVTLMSPDIVMAVSLLVLFIGLHLELGLFTLWL 146 Query: 134 SHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPLAMPAVAAGWVLSF 193 +H FCLPFV +TV++RL+GFD ++EAA+DLGA E+T +R+++LPLA+PA+AAGW++SF Sbjct: 147 AHTGFCLPFVTLTVHARLQGFDNALVEAARDLGAGEWTAIRRVVLPLALPAIAAGWLMSF 206 Query: 194 TLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVLSLVMVIASQ-LIA 252 TLS+DD VVS FVTGP +E+LPL+IYSMV++GV PEVNALA++L +SL V+ +Q L+ Sbjct: 207 TLSLDDAVVSFFVTGPDFEVLPLRIYSMVRLGVKPEVNALASLLFAVSLSFVVLAQWLLL 266 Query: 253 RDK 255 +D+ Sbjct: 267 KDR 269 Lambda K H 0.329 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 270 Length adjustment: 25 Effective length of query: 239 Effective length of database: 245 Effective search space: 58555 Effective search space used: 58555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory