Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate WP_010960458.1 MCA_RS05745 NAD-dependent epimerase/dehydratase family protein
Query= BRENDA::Q9WYX9 (309 letters) >NCBI__GCF_000008325.1:WP_010960458.1 Length = 320 Score = 152 bits (383), Expect = 1e-41 Identities = 106/316 (33%), Positives = 165/316 (52%), Gaps = 17/316 (5%) Query: 3 ILVTGGAGFIGSHVVDKLIENGYGVIVVDNLSSGKVENLNRNALFYEQSIEDEEMMERI- 61 ILVTGGAGF+GSH+ + L+ G+ V+ VDN +G +N+ L + E + + Sbjct: 9 ILVTGGAGFLGSHLCESLLGLGHDVLCVDNFFTGSRDNI----LHLLGNPHFELLRHDVT 64 Query: 62 FSLH-RPEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKKFIFSSTGGA 120 F L+ + +++LA AS +P + KT++ G++ +L + VK IF ++ Sbjct: 65 FPLYVEVDEIYNLACPASPIHYQFDPVQTTKTSVHGAINML--GLAKRVKAKIFQASTSE 122 Query: 121 IYGENVKVFPTPETEIPH--PISP---YGIAKYSTEMYLEFFAREYGLKYTVLRYANVYG 175 +YG+ +V P E + H PI P Y K E + R++ L V R N YG Sbjct: 123 VYGDP-EVHPQTEDYVGHVNPIGPRSCYDEGKRCAETLFFDYRRQHNLSIKVARIFNTYG 181 Query: 176 PRQDPYGEAGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLAMEKGDNEV-- 233 PR P + VV+ F + L+G+ + ++GDGE R + YV D++ + M+ D+ Sbjct: 182 PRMHP-NDGRVVSNFIVQALKGQPITLYGDGEQTRSFCYVSDLIEGFIRLMDSPDDFTGP 240 Query: 234 FNIGTGRGTTVNQLFKLLKEITGYDKEPVYKPPRKGDVRKSILDYTKAKEKLGWEPKVSL 293 N+G T+ QL + + E+TG + VY+P D R+ D T AKEKL WEP + L Sbjct: 241 VNLGNPGEFTIRQLAEKIIEMTGSSSKLVYQPLPVDDPRQRRPDITLAKEKLDWEPTIHL 300 Query: 294 EEGLKLTVEYFRKTLE 309 EEGL T+ YF L+ Sbjct: 301 EEGLVHTITYFDDLLQ 316 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 320 Length adjustment: 27 Effective length of query: 282 Effective length of database: 293 Effective search space: 82626 Effective search space used: 82626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory