Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_010960657.1 MCA_RS06790 molybdenum import ATP-binding protein ModC
Query= TCDB::P31134 (377 letters) >NCBI__GCF_000008325.1:WP_010960657.1 Length = 356 Score = 139 bits (349), Expect = 2e-37 Identities = 77/204 (37%), Positives = 122/204 (59%), Gaps = 7/204 (3%) Query: 37 DVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGV----DLSQVPPYLRP 92 DV LT+ + AL G SG GK+TLLR +AG E+ SAG++ +G + VP + RP Sbjct: 18 DVDLTLPGRGVTALFGHSGSGKTTLLRCIAGIERVSAGRLTFNGEVWQDEKIWVPTHKRP 77 Query: 93 INMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHMQEFAKRKPHQLSG 152 + +FQ +LFPH+TV N+ FG+K+ P + E+LG+ H+ + RKP +LSG Sbjct: 78 LGYVFQEASLFPHLTVLGNLRFGMKRASGPVRVSLDQAVELLGIGHLLD---RKPDRLSG 134 Query: 153 GQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEE 212 G+RQRVA+AR+LA P++LL+DEP+ ALD K + + + + + + + + V+H +E Sbjct: 135 GERQRVAIARALAVSPRVLLMDEPLAALDLKRKQEILPYLERLHDELDIPVLYVSHSPDE 194 Query: 213 AMTMAGRIAIMNRGKFVQIGEPEE 236 +A + M G+ + G +E Sbjct: 195 VARLADHLVAMEEGRVIAAGPLKE 218 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 356 Length adjustment: 30 Effective length of query: 347 Effective length of database: 326 Effective search space: 113122 Effective search space used: 113122 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory