Align N-carbamoylputrescine amidohydrolase (EC 3.5.1.53) (characterized)
to candidate WP_010961114.1 MCA_RS09150 apolipoprotein acyltransferase
Query= metacyc::MONOMER-17350 (290 letters) >NCBI__GCF_000008325.1:WP_010961114.1 Length = 295 Score = 346 bits (887), Expect = e-100 Identities = 163/291 (56%), Positives = 215/291 (73%), Gaps = 1/291 (0%) Query: 1 MKIALIQQKFHSNKEQTIKKTCEFIEEASKQGAELICLGELHQSEYFCQSENVDFFDYAN 60 +++AL+QQ + ++EQ + + E I + +GA+L+ L ELH YFCQ+E+ FD A Sbjct: 5 IELALVQQACNGSREQNLAASVEGIRRSKAKGADLVMLPELHLGPYFCQTEDCSCFDGAE 64 Query: 61 DYEKDVKF-WANIARKNQIVLITSLFEKRSAGLYHNTAVVFEKDGSIAGKYRKMHIPDDP 119 ++AR+ +V++ SLFE+R+ GLYHNTAVV + DGS+AGKYRKMHIPDDP Sbjct: 65 TIPGPTTAELGSVARELGVVVVASLFERRAPGLYHNTAVVLDSDGSLAGKYRKMHIPDDP 124 Query: 120 CFYEKFYFTPGDLGFEPINTSLGKLGVLICWDQWYPEAARIMALKGAEILIYPTAIGWFD 179 +YEKFYFTPGDLGF PI+TS+G+LGVL+CWDQWYPEAAR+MAL GA++L+YPTAIGW Sbjct: 125 GYYEKFYFTPGDLGFRPIDTSVGRLGVLVCWDQWYPEAARLMALAGADLLLYPTAIGWNP 184 Query: 180 KDKDEEKQRQLNAWLGVQKGHAIANGLYVVAINRVGFEKDVSGVEEGIRFWGNSFVFGPQ 239 D + E+ RQL AW+ VQ+GHA+ANGL V A NR+G E D SG GI FWGNSF GPQ Sbjct: 185 ADDEVERSRQLEAWITVQRGHAVANGLTVAACNRIGSEPDPSGQTPGILFWGNSFAAGPQ 244 Query: 240 GEELCLLDSQNECVKIIEIDKKRSENVRRWWPFLRDRRIEYFADLTKRFID 290 GE LC S + + ++ +D+KRSE+VRR WPFLRDRRI+ + L +R++D Sbjct: 245 GEFLCRAGSADTELLMVTVDRKRSEDVRRIWPFLRDRRIDGYDGLLRRYLD 295 Lambda K H 0.322 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 295 Length adjustment: 26 Effective length of query: 264 Effective length of database: 269 Effective search space: 71016 Effective search space used: 71016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory