Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate WP_010961795.1 MCA_RS12635 molybdate ABC transporter permease subunit
Query= CharProtDB::CH_088337 (275 letters) >NCBI__GCF_000008325.1:WP_010961795.1 Length = 222 Score = 65.1 bits (157), Expect = 1e-15 Identities = 51/164 (31%), Positives = 78/164 (47%), Gaps = 4/164 (2%) Query: 58 SLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTK 117 SL +A AT LV G + LA+ R L+ L +P + Y L + + Sbjct: 11 SLKVAGWATAIDLVFGVAVGFLLARGRFPGRDLIETTLALPMVLPPTVLGYYLLVMI--- 67 Query: 118 GYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDL 177 G +EF WL I ++FT A +I + P + P ++ E +D L +AAR L Sbjct: 68 GRRSEFGAWLHG-QFGIDLVFTWQAAVIAASIVAFPLVFKPARAAFEAVDPQLEQAARVL 126 Query: 178 GASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGA 221 G S+ F R+ +PL GI+AG LL A+G F + ++ G+ Sbjct: 127 GISEPAIFFRVTLPLAWRGILAGLLLAFARALGEFGATLMVAGS 170 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 222 Length adjustment: 24 Effective length of query: 251 Effective length of database: 198 Effective search space: 49698 Effective search space used: 49698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory