Align Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of branched-chain alpha-keto acid dehydrogenase complex; LPD-Val; EC 1.8.1.4 (characterized)
to candidate WP_010962193.1 MCA_RS14735 CoA-disulfide reductase
Query= SwissProt::P09063 (459 letters) >NCBI__GCF_000008325.1:WP_010962193.1 Length = 560 Score = 87.8 bits (216), Expect = 8e-22 Identities = 71/216 (32%), Positives = 110/216 (50%), Gaps = 20/216 (9%) Query: 139 LLLATGSSSVELPMLPLGGPVISSTEAL-------APKALPQHLVVVGGGYIGLELGIAY 191 L+LATG+ V P+ + P I + A A + +V+VGGG+IGLE+ Sbjct: 113 LVLATGAQPVRPPLPGIDLPGIHVLRTIPDSRGIKAAVAHAKRVVLVGGGFIGLEMAENL 172 Query: 192 RKLGAQVSVVEARERILPTYDSELTAPVAESLKKLGIALHLGHSVEGY----ENGCLLAN 247 LG +V+++E +++LP D E+ AE LK G++L LG VE + E+G L Sbjct: 173 VGLGLEVTLLELADQVLPPLDPEMATYAAERLKTHGVSLRLGEGVEAFDKHPEHG-LNLR 231 Query: 248 DGKGGQLRLEADRVLVAVGRRPRTKGFNLECLDLKMNGAAIAIDERCQTSMHNVWAIGDV 307 KGG + AD V++ +G RP + L+L G I +DE +TS +WA+GDV Sbjct: 232 TSKGG--TIAADLVILGIGVRPESGLAAAAGLELGAFG-GIRVDEYMRTSDAAIWAVGDV 288 Query: 308 AGEPMLAHRAMAQGEMVAEIIAGKARRFEPAAIAAV 343 + +R + ++V +AG A R A A+ Sbjct: 289 V---EVKNRVTGEWQLVP--LAGPANRQGRVAATAI 319 Lambda K H 0.319 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 34 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 560 Length adjustment: 34 Effective length of query: 425 Effective length of database: 526 Effective search space: 223550 Effective search space used: 223550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory