Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_010966449.1 CA_RS16290 3-isopropylmalate dehydratase small subunit
Query= BRENDA::Q58673 (168 letters) >NCBI__GCF_000008765.1:WP_010966449.1 Length = 163 Score = 183 bits (465), Expect = 1e-51 Identities = 87/158 (55%), Positives = 117/158 (74%) Query: 5 IKGRVWKFGNNVDTDAILPARYLVYTKPEELAQFVMTGADPDFPKKVKPGDIIVGGKNFG 64 + G V K+G+N+DTD I+PARYL + PEELA+ M D DF KK+K GDI+VGG+NFG Sbjct: 3 VNGDVLKYGDNIDTDVIIPARYLNTSVPEELAKHCMEDLDVDFLKKLKTGDIVVGGRNFG 62 Query: 65 CGSSREHAPLGLKGAGISCVIAESFARIFYRNAINVGLPLIECKGISEKVNEGDELEVNL 124 CGSSREHAP+ +K AG+SCVIA+SFARIFYRN+IN+G P++EC+ + GD+LEV+ Sbjct: 63 CGSSREHAPICIKAAGVSCVIAKSFARIFYRNSINIGFPILECEEAVNDASTGDKLEVDF 122 Query: 125 ETGEIKNLTTGEVLKGQKLPEFMMEILEAGGLMPYLKK 162 G IKN+T + K Q P+FM++I++ GL +KK Sbjct: 123 IEGIIKNVTLNKEYKAQPFPDFMLKIMKNEGLTNCVKK 160 Lambda K H 0.317 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 163 Length adjustment: 18 Effective length of query: 150 Effective length of database: 145 Effective search space: 21750 Effective search space used: 21750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_010966449.1 CA_RS16290 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR02084 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.456.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.456.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.