Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_010994303.1 AVA_RS07575 sulfate/molybdate ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000204075.1:WP_010994303.1 Length = 338 Score = 194 bits (492), Expect = 4e-54 Identities = 109/282 (38%), Positives = 176/282 (62%), Gaps = 15/282 (5%) Query: 4 IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63 I+V+NVSK F G A+D VN+ I++G+ +LGPSG+GK+T +R+IAGL+ P G + Sbjct: 3 IVVENVSKQF--GSFRAVDQVNLEIQSGKLVALLGPSGSGKSTLLRLIAGLEKPDDGRII 60 Query: 64 FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEE 123 + A+N + ++R IG VFQ +AL+ +LT +NIAF L K +++ RVE+ Sbjct: 61 LTGK-DATNQSV----QERNIGFVFQHYALFKHLTVRQNIAFGLEIRKAPANKVKGRVEQ 115 Query: 124 VAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALV 183 + +++ + + + +P +LSGGQ+QRVALARAL +PS+LLLDEPF LDA++R RA + Sbjct: 116 LLELVQLSGLGDRYPSQLSGGQRQRVALARALAVEPSVLLLDEPFGALDAKVRKDLRAWL 175 Query: 184 KEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGE 243 + + + VT + V+HD + ++D V V+ +G++ QVG P ++YDNP + V S IG Sbjct: 176 RRLHDEVHVTTVFVTHDQEEAMEVSDEVVVMNQGRVEQVGTPAEIYDNPATSFVMSFIGP 235 Query: 244 INELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSK 285 +N L + + S + + + + +RP+DV + K Sbjct: 236 VNVL----PSSSRIFQSSQLEI----EHPNVFLRPQDVVIEK 269 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 338 Length adjustment: 29 Effective length of query: 324 Effective length of database: 309 Effective search space: 100116 Effective search space used: 100116 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory