GapMind for catabolism of small carbon sources

 

Alignments for a candidate for SemiSWEET in Trichormus variabilis ATCC 29413

Align Sugar transporter SemiSWEET (characterized)
to candidate WP_010994969.1 AVA_RS02975 hypothetical protein

Query= SwissProt::B0SR19
         (85 letters)



>NCBI__GCF_000204075.1:WP_010994969.1
          Length = 84

 Score = 76.6 bits (187), Expect = 5e-20
 Identities = 35/76 (46%), Positives = 50/76 (65%)

Query: 4  LIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILA 63
          ++G+ AA LTT SFLPQ+++   +K  +D+S  M I F  G+ LW +YGI+   LP+I A
Sbjct: 6  VLGFAAALLTTFSFLPQMIKTWQSKSAKDVSFIMLIFFNTGIFLWLIYGIILQQLPVIFA 65

Query: 64 NVVTLFFVTIILYYKL 79
          N  TL F  IIL+ K+
Sbjct: 66 NATTLVFNMIILWLKI 81


Lambda     K      H
   0.334    0.147    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 36
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 85
Length of database: 84
Length adjustment: 8
Effective length of query: 77
Effective length of database: 76
Effective search space:     5852
Effective search space used:     5852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (21.1 bits)
S2: 38 (19.2 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory