Align IGP synthase, amidotransferase subunit (EC 4.3.2.10) (characterized)
to candidate WP_011020951.1 MA_RS04735 imidazole glycerol phosphate synthase subunit HisH
Query= reanno::HerbieS:HSERO_RS20325 (212 letters) >NCBI__GCF_000007345.1:WP_011020951.1 Length = 202 Score = 166 bits (419), Expect = 4e-46 Identities = 93/212 (43%), Positives = 132/212 (62%), Gaps = 17/212 (8%) Query: 1 MNKIVVVDYGMGNLRSVAQALRHVAPEADVRISGEVADIRAADRVVLPGQGAMPDCMRSL 60 M +IV++DYG+GNLRSV + L HV A+ ISG +I AD ++LPG GA D M+ L Sbjct: 1 MKRIVIIDYGLGNLRSVQKGLEHVG--ANPAISGNPEEILTADGIILPGVGAFIDAMKCL 58 Query: 61 RESGVQDAVIE-ASRTKPLFGVCVGEQMLFDWSEEGD-TPGLGLLPGKVVRFDLEGMRQD 118 ++ + E A KP+ G+C+G+Q+L SEEG T GL L+ G+V+RF Sbjct: 59 IP--LKGVIAEFAESGKPMLGICLGQQVLMSSSEEGRLTGGLDLIQGRVLRFPK------ 110 Query: 119 DGSLFKVPQMGWNHVHQTSRHPLWEGIADNAFFYFVHSYYAVPAESAHVVGQTPYGRDFA 178 S KVP MGWN++ HPL++GI+D +F YFVHSYY V + + + YG DF+ Sbjct: 111 --SELKVPHMGWNNIRIKQDHPLFKGISDGSFVYFVHSYY-VDTTAENTLASCEYGLDFS 167 Query: 179 CAV--ARDNIFATQFHPEKSASAGLQLYRNFV 208 +V ++ N+ TQFHPEKS + GL++ +NFV Sbjct: 168 ASVVNSKGNVMGTQFHPEKSGTTGLKILKNFV 199 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 9 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 202 Length adjustment: 21 Effective length of query: 191 Effective length of database: 181 Effective search space: 34571 Effective search space used: 34571 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_011020951.1 MA_RS04735 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.19924.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.19924.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.