Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate WP_011024398.1 MA_RS23585 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
Query= curated2:Q12VH0 (93 letters) >NCBI__GCF_000007345.1:WP_011024398.1 Length = 93 Score = 120 bits (301), Expect = 4e-33 Identities = 57/92 (61%), Positives = 72/92 (78%) Query: 1 MITKDEVEHVGWLARIEIGAAEAEDYAVKLSSVLDYFGQLDEVDTEGVEPTYHVADIMNV 60 MITK++VEH+GWLARI+I E +Y KL+SVL+YFGQLDE+ TE V PTYHVA+I NV Sbjct: 1 MITKEDVEHIGWLARIDINEQETVEYMEKLNSVLEYFGQLDELPTEDVAPTYHVAEIHNV 60 Query: 61 FREDVVKPSLDQKDVLANTAEEKDGYIKAPRI 92 FREDVV+ L Q+ VLANT ++DG + P+I Sbjct: 61 FREDVVEECLSQETVLANTEHKQDGTFRVPKI 92 Lambda K H 0.314 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 59 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 93 Length of database: 93 Length adjustment: 10 Effective length of query: 83 Effective length of database: 83 Effective search space: 6889 Effective search space used: 6889 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.6 bits) S2: 39 (19.6 bits)
Align candidate WP_011024398.1 MA_RS23585 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.4977.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.4977.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.