Protein WP_011032906.1 in Methanosarcina mazei Go1
Annotation: NCBI__GCF_000007065.1:WP_011032906.1
Length: 329 amino acids
Source: GCF_000007065.1 in NCBI
Candidate for 22 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-isoleucine catabolism | livF | lo | ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) | 32% | 95% | 124 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-leucine catabolism | livF | lo | ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) | 32% | 95% | 124 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-valine catabolism | livF | lo | ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) | 32% | 95% | 124 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| 2'-deoxyinosine catabolism | nupA | lo | Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized) | 31% | 54% | 118.6 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-arginine catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 31% | 95% | 117.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-glutamate catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 31% | 95% | 117.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-histidine catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 31% | 95% | 117.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-isoleucine catabolism | livG | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 31% | 95% | 117.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-leucine catabolism | livG | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 31% | 95% | 117.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-valine catabolism | livG | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 31% | 95% | 117.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-alanine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 94% | 117.1 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-proline catabolism | HSERO_RS00895 | lo | ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) | 30% | 95% | 117.1 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-serine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 94% | 117.1 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-threonine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 94% | 117.1 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-alanine catabolism | braF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 30% | 96% | 112.8 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-serine catabolism | braF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 30% | 96% | 112.8 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-threonine catabolism | braF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 30% | 96% | 112.8 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-phenylalanine catabolism | livF | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 92% | 110.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-proline catabolism | HSERO_RS00900 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 92% | 110.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-serine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 92% | 110.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| L-tyrosine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 92% | 110.9 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
| D-xylose catabolism | xylG | lo | Xylose import ATP-binding protein XylG; EC 7.5.2.10 (characterized) | 30% | 50% | 109.8 | ABC-type xenobiotic transporter (EC 7.6.2.2) | 36% | 211.5 |
Sequence Analysis Tools
View WP_011032906.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MTANVIEVNNLEHSYGSVKAVDNISFSVKEGEIFSFLGPNGAGKSTVINILTTLRKIQKG
EARVNGYDVAKEAKSVRKSIGIVFQMLCLDHEMTVCENLEYHGKIYSMPKNERKKRIEEL
LILTELEHKKDTLAKDLSGGMKRRLELARGLMTKPAVLFLDEPTIGFDIQTRMRMWEYLR
EIKREGTTIFLTTHYMEEADQLSDRISIIDHGKIIVTGTADELKNKLGKDLIYLETSDNK
IAADILRAIKSVKTVTEDTKSLRVMIGEDVTHVLPQIIEQIRKAGLEITTVNIKKPSMDD
VFVHYTGHGLREGEPQEKPEGIEVLGASE
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory