Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011156796.1 TX73_RS06290 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000195775.1:WP_011156796.1 Length = 253 Score = 197 bits (501), Expect = 2e-55 Identities = 109/263 (41%), Positives = 158/263 (60%), Gaps = 17/263 (6%) Query: 13 TLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMIT 72 T KV+ L++KFGGL A++D SF+ G++ +IGPNGAGKTT+FN I+ Y P G I Sbjct: 3 TFFKVDKLTVKFGGLTAVDDVSFDIAEGEVFTIIGPNGAGKTTLFNLISRLYTPYAGHII 62 Query: 73 FNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTI 132 F + + RL +I +ARTFQNI LF + L+NLLV +H ++ I Sbjct: 63 FRDED-----VTRLSAQQIAGRG-IARTFQNIELFESASTLDNLLVGRHRHSTTSTWQDI 116 Query: 133 LGLIGVGP----YKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCT 188 L L V ++R A E +++ R + D P G LPYG ++ +E+ARA+C Sbjct: 117 LRLRKVRDEEIAHRRAAEEVMDVLRLQRYR-------DTPIGSLPYGVRKVIEVARALCV 169 Query: 189 GPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYG 248 GP+LL LDEP++GLN E+ + + I G ++L++EHDMS+V +SD V+ L YG Sbjct: 170 GPKLLLLDEPSSGLNVEETNAMAEWILEINNRLGITVLMVEHDMSLVSRVSDRVLALNYG 229 Query: 249 QKISDGTPDHVKNDPRVIAAYLG 271 + ++ GT D V+N P V+AAYLG Sbjct: 230 RMMALGTSDEVQNHPDVVAAYLG 252 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 253 Length adjustment: 25 Effective length of query: 267 Effective length of database: 228 Effective search space: 60876 Effective search space used: 60876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory