Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_011157258.1 TX73_RS08940 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000195775.1:WP_011157258.1 Length = 234 Score = 228 bits (581), Expect = 8e-65 Identities = 114/233 (48%), Positives = 165/233 (70%), Gaps = 1/233 (0%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 ML V+T Y + A+ +V++EV QGEIV + GANGAGKSTLL ++ G+ + SG + + Sbjct: 1 MLSVREVTTAYKGLVAISNVSIEVEQGEIVCVAGANGAGKSTLLKSIAGAERIRSGQVLF 60 Query: 61 MGEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGF-FTDKGDYQEQMDKVLHL 119 GE L G I ++ +A VPE RR+F RL+V +NL +G + + + D ++ ++ V L Sbjct: 61 DGERLDGVPQHVITKRGVAYVPENRRLFPRLSVHDNLRLGSYLYRGEADREKPLEFVFSL 120 Query: 120 FPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQL 179 FPRL+ER QR T+SGGEQQMLAIGRALM++P+LL+LDEPS G+ P ++ +IF ++++ Sbjct: 121 FPRLQERLEQRAETLSGGEQQMLAIGRALMTRPRLLMLDEPSQGIMPKLVSEIFQSVKKI 180 Query: 180 RKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 R G+TV +VEQ + L+IADRAY+L+ GRV+MQG L+ +P VR+AYLG Sbjct: 181 RDAGMTVLIVEQRMAECLEIADRAYILQTGRVLMQGKAAELMDNPDVRKAYLG 233 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 234 Length adjustment: 23 Effective length of query: 210 Effective length of database: 211 Effective search space: 44310 Effective search space used: 44310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory