Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_011159557.1 TX73_RS20510 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000195775.1:WP_011159557.1 Length = 260 Score = 231 bits (589), Expect = 1e-65 Identities = 113/249 (45%), Positives = 170/249 (68%), Gaps = 1/249 (0%) Query: 5 ILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRL 64 +L+VS + + FGG+ A++GV V +++S+IGPNGAGKTT+FN ++G Y G I L Sbjct: 3 LLKVSDVGISFGGVKAIDGVGFSVAPGEILSIIGPNGAGKTTLFNVVSGMYAADHGRIDL 62 Query: 65 DGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFR 124 DG ++ GLP ++A +G+ RTFQN+++F MTA EN++V +H + A L + P+ Sbjct: 63 DGRDVTGLPPDELATRGLSRTFQNLQIFHRMTAAENVMVGRHLQERCSLFADLLRLPSVT 122 Query: 125 RSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGL 184 R R A L++V L + A+ +AG+L+YG +RLEIAR + PR+L+LDEPAAG Sbjct: 123 RQNRATRAAALTLLDQVGLRDIADVAAGSLSYGASKRLEIARALAAEPRVLLLDEPAAGC 182 Query: 185 NPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRDN 244 N ET+++ LI ++ ++ + V+L+EHDMKLVM IS I+V+NQG L +GTP+++R N Sbjct: 183 NSVETEEIDRLICRV-ADQGIAVVLVEHDMKLVMKISHRILVLNQGRMLVEGTPDEVRHN 241 Query: 245 PDVIKAYLG 253 P V +AYLG Sbjct: 242 PLVAEAYLG 250 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 260 Length adjustment: 24 Effective length of query: 231 Effective length of database: 236 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory